F146162

General Info

Members Datasets Scaffolds Average Seq Length
130 83 260 161

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10088266|Ga0307510_100882662
Length 188
Sequence MIGNDVVDLIQSRHESNWQRKGFIEKLFTAEEQLLIKHDSNPEIMVWLLWSMKEAAYKIYNRQTKLRQYIPKKLICNIVSNNNNCITGQVTCCENVYHTKTTIFTDSIHTIAVSFLHDLNNVIEIENTGIIKDQYGIPYLNTLQNRIKDVSITHHGRFEKVVTIIKKNNRQNQQDSVLDNIKFHCTNL

Samples

Sample ID Description Type Environment
1 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
8 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
9 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
10 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
11 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
12 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
13 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
18 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
19 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
20 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
21 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
23 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
24 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
25 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
26 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
27 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
28 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
29 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
30 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
31 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
32 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
33 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
34 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
35 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
36 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
37 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
38 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
39 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
40 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
41 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
42 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
43 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
44 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
45 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
46 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
47 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
48 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
49 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
50 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
51 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
52 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
53 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
54 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
55 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
56 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
57 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
58 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
59 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
60 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
61 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
62 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
63 2738541284 Pedobacter sp. YR016 Isolate Unclassified
64 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
65 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
66 2739367651 Pedobacter sp. OK291 Isolate Unclassified
67 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
68 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
69 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
70 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
71 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
72 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
73 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
74 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
75 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
76 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
77 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
78 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
79 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
80 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
81 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
82 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
83 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.23
Metatranscriptomes 0
Isolates 20.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.92
Nodule 1.54
Rhizoplane 0.77
Rhizosphere 73.08
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307510_10088266 3300033180 Bacteria 2961
2 SwRhRL2b_contig_1463173 2162886007 Bacteria 8874
3 SwRhRL2b_contig_204006 2162886007 Bacteria 919
4 rootH1_10368997 3300003323 Bacteria 1922
5 Ga0065714_10002785 3300005288 Bacteria 18311
6 Ga0065714_10004953 3300005288 Bacteria 10985
7 Ga0065714_10007238 3300005288 Bacteria 7198
8 Ga0065714_10011419 3300005288 Bacteria 2929
9 Ga0065714_10015211 3300005288 Bacteria 1832
10 Ga0065704_10000251 3300005289 Bacteria 69899
11 Ga0065704_10076259 3300005289 Bacteria 5200
12 Ga0065704_10186540 3300005289 Unclassified 1210
13 Ga0070682_100059842 3300005337 Bacteria 2407
14 Ga0068852_100465901 3300005616 Bacteria 1253
15 Ga0079104_1000139 3300006946 Bacteria 102950
16 Ga0105251_10331469 3300009011 Bacteria 692
17 Ga0105250_10099562 3300009092 Bacteria 1186
18 Ga0157373_10000296 3300013100 Bacteria 40219
19 Ga0157373_10009418 3300013100 Bacteria 7213
20 Ga0157373_10047978 3300013100 Bacteria 3045
21 Ga0157373_10208804 3300013100 Bacteria 1377
22 Ga0157373_10916057 3300013100 Bacteria 651
23 Ga0157371_10000041 3300013102 Bacteria 203957
24 Ga0157371_10000697 3300013102 Bacteria 39526
25 Ga0157371_10001043 3300013102 Bacteria 30400
26 Ga0157371_10006115 3300013102 Bacteria 10007
27 Ga0157370_10000043 3300013104 Bacteria 132770
28 Ga0157370_10000195 3300013104 Bacteria 76072
29 Ga0157370_10001249 3300013104 Bacteria 31757
30 Ga0157370_10027674 3300013104 Bacteria 5589
31 Ga0157370_10243174 3300013104 Bacteria 1665
32 Ga0157370_10270095 3300013104 Bacteria 1571
33 Ga0157369_10000016 3300013105 Bacteria 257827
34 Ga0157369_10001214 3300013105 Bacteria 32084
35 Ga0163162_10000813 3300013306 Bacteria 28949
36 Ga0163162_10052413 3300013306 Bacteria 4098
37 Ga0182008_10000010 3300014497 Bacteria 301527
38 Ga0182006_1001062 3300015261 Bacteria 17672
39 Ga0182006_1003953 3300015261 Bacteria 7413
40 Ga0182006_1021660 3300015261 Bacteria 2678
41 Ga0182007_10000002 3300015262 Bacteria 564661
42 Ga0183373_1004 3300015682 Bacteria 537398
43 Ga0163161_10000026 3300017792 Bacteria 199745
44 Ga0163161_10000593 3300017792 Bacteria 29004
45 Ga0163161_10001199 3300017792 Bacteria 19518
46 Ga0207696_1100898 3300025711 Bacteria 786
47 Ga0209281_1000351 3300027111 Bacteria 75878
48 Ga0307515_10415375 3300028794 Bacteria 967
49 Ga0316181_1080040 3300030744 Bacteria 3114
50 Ga0307513_10230754 3300031456 Bacteria 1664
51 Ga0307408_100007659 3300031548 Bacteria 7142
52 Ga0307405_10000006 3300031731 Bacteria 361477
53 Ga0307413_10000748 3300031824 Bacteria 11212
54 Ga0307410_10000028 3300031852 Bacteria 50901
55 Ga0307406_10000153 3300031901 Bacteria 41029
56 Ga0307407_10000003 3300031903 Bacteria 271723
57 Ga0307407_10613491 3300031903 Bacteria 811
58 Ga0307412_10000009 3300031911 Bacteria 445987
59 Ga0307409_100004918 3300031995 Bacteria 7605
60 Ga0307416_100000002 3300032002 Bacteria 509907
61 Ga0307414_10000002 3300032004 Bacteria 623006
62 Ga0307414_10004727 3300032004 Bacteria 7430
63 Ga0307414_10012369 3300032004 Bacteria 5043
64 Ga0307414_10015600 3300032004 Bacteria 4588
65 Ga0307414_10050485 3300032004 Bacteria 2882
66 Ga0307414_10050737 3300032004 Bacteria 2876
67 Ga0307414_10154153 3300032004 Bacteria 1816
68 Ga0307414_10183728 3300032004 Bacteria 1684
69 Ga0307414_10634613 3300032004 Bacteria 961
70 Ga0307414_10803153 3300032004 Bacteria 858
71 Ga0307414_10910770 3300032004 Bacteria 806
72 Ga0307414_11113228 3300032004 Bacteria 729
73 Ga0307411_10000001 3300032005 Bacteria 931810
74 Ga0307411_10862684 3300032005 Unclassified 802
75 Ga0439466_0000701 3300041411 Bacteria 12658
76 Ga0451797_1186905 3300041453 Bacteria 866
77 Ga0495627_097957 3300046453 Bacteria 839
78 Ga0495606_0033346 3300046507 Bacteria 3552
79 Ga0495606_0248447 3300046507 Bacteria 988
80 Ga0495616_0128896 3300046513 Bacteria 1161
81 Ga0495643_0000970 3300046522 Bacteria 29411
82 Ga0495625_0061141 3300046660 Bacteria 2666
83 Ga0496121_0017736 3300048924 Bacteria 7243
84 Ga0501224_028949 3300049664 Bacteria 829
85 Ga0501238_000148 3300049671 Bacteria 10810
86 Ga0501249_000004 3300049679 Bacteria 226777
87 Ga0501249_029630 3300049679 Bacteria 1217
88 Ga0501249_047387 3300049679 Bacteria 983
89 Ga0501241_003317 3300049758 Bacteria 3043
90 Ga0501241_005986 3300049758 Bacteria 2255
91 Ga0501241_007610 3300049758 Bacteria 1984
92 Ga0501241_032183 3300049758 Bacteria 994
93 Ga0501266_000014 3300049763 Bacteria 181600
94 Ga0501266_002966 3300049763 Bacteria 2114
95 Ga0500644_0087167 3300053088 Bacteria 1161
96 Ga0500651_0000528 3300053093 Bacteria 19528
97 Ga0500641_0000007 3300053096 Bacteria 206510
98 Ga0500641_0000051 3300053096 Bacteria 53081
99 Ga0500641_0000366 3300053096 Bacteria 16777
100 Ga0500658_0000003 3300053134 Bacteria 512506
101 Ga0500559_0119613 3300053136 Bacteria 1224
102 Ga0500589_134841 3300053147 Bacteria 1026
103 Ga0500584_003408 3300053726 Bacteria 6292
104 2513233553 2513020052 Bacteria 5120511
105 2586207758 2585427687 Bacteria 5544917
106 2644372776 2643221667 Bacteria 5627472
107 2644644397 2643221716 Bacteria 4986332
108 2644682854 2643221725 Bacteria 5087956
109 2738732234 2738541279 Bacteria 6149495
110 2738760694 2738541284 Bacteria 5199923
111 2738764799 2738541285 Bacteria 6150075
112 2739213814 2738543007 Bacteria 6149845
113 2739588006 2739367651 Bacteria 6359826
114 2740001952 2739367857 Bacteria 5433684
115 2740006768 2739367858 Bacteria 5432813
116 2776612897 2775506987 Bacteria 5373360
117 2802654531 2802428842 Bacteria 4926114
118 2842724215 2842722452 Bacteria 6263924
119 2849282527 2849281842 Bacteria 6065644
120 2857617440 2857613821 Bacteria 4917088
121 2857618862 2857618242 Bacteria 5635925
122 2904420645 2904419702 Bacteria 5166287
123 2904560040 2904555929 Bacteria 5218588
124 2919686703 2919683626 Bacteria 5534354
125 2929152313 2929150217 Bacteria 5462483
126 2945998961 2945997725 Bacteria 6404843
127 2954021413 2954016120 Bacteria 6446024
128 2977270550 2977268062 Bacteria 5243061
129 8055423746 8055419101 Bacteria 5289643
130 8055592839 8055592153 Bacteria 5961247
131 Ga0307510_10088266
132 SwRhRL2b_contig_1463173
133 SwRhRL2b_contig_204006
134 rootH1_10368997
135 Ga0065714_10002785
136 Ga0065714_10004953
137 Ga0065714_10007238
138 Ga0065714_10011419
139 Ga0065714_10015211
140 Ga0065704_10000251
141 Ga0065704_10076259
142 Ga0065704_10186540
143 Ga0070682_100059842
144 Ga0068852_100465901
145 Ga0079104_1000139
146 Ga0105251_10331469
147 Ga0105250_10099562
148 Ga0157373_10000296
149 Ga0157373_10009418
150 Ga0157373_10047978
151 Ga0157373_10208804
152 Ga0157373_10916057
153 Ga0157371_10000041
154 Ga0157371_10000697
155 Ga0157371_10001043
156 Ga0157371_10006115
157 Ga0157370_10000043
158 Ga0157370_10000195
159 Ga0157370_10001249
160 Ga0157370_10027674
161 Ga0157370_10243174
162 Ga0157370_10270095
163 Ga0157369_10000016
164 Ga0157369_10001214
165 Ga0163162_10000813
166 Ga0163162_10052413
167 Ga0182008_10000010
168 Ga0182006_1001062
169 Ga0182006_1003953
170 Ga0182006_1021660
171 Ga0182007_10000002
172 Ga0183373_1004
173 Ga0163161_10000026
174 Ga0163161_10000593
175 Ga0163161_10001199
176 Ga0207696_1100898
177 Ga0209281_1000351
178 Ga0307515_10415375
179 Ga0316181_1080040
180 Ga0307513_10230754
181 Ga0307408_100007659
182 Ga0307405_10000006
183 Ga0307413_10000748
184 Ga0307410_10000028
185 Ga0307406_10000153
186 Ga0307407_10000003
187 Ga0307407_10613491
188 Ga0307412_10000009
189 Ga0307409_100004918
190 Ga0307416_100000002
191 Ga0307414_10000002
192 Ga0307414_10004727
193 Ga0307414_10012369
194 Ga0307414_10015600
195 Ga0307414_10050485
196 Ga0307414_10050737
197 Ga0307414_10154153
198 Ga0307414_10183728
199 Ga0307414_10634613
200 Ga0307414_10803153
201 Ga0307414_10910770
202 Ga0307414_11113228
203 Ga0307411_10000001
204 Ga0307411_10862684
205 Ga0439466_0000701
206 Ga0451797_1186905
207 Ga0495627_097957
208 Ga0495606_0033346
209 Ga0495606_0248447
210 Ga0495616_0128896
211 Ga0495643_0000970
212 Ga0495625_0061141
213 Ga0496121_0017736
214 Ga0501224_028949
215 Ga0501238_000148
216 Ga0501249_000004
217 Ga0501249_029630
218 Ga0501249_047387
219 Ga0501241_003317
220 Ga0501241_005986
221 Ga0501241_007610
222 Ga0501241_032183
223 Ga0501266_000014
224 Ga0501266_002966
225 Ga0500644_0087167
226 Ga0500651_0000528
227 Ga0500641_0000007
228 Ga0500641_0000051
229 Ga0500641_0000366
230 Ga0500658_0000003
231 Ga0500559_0119613
232 Ga0500589_134841
233 Ga0500584_003408
234 2513233553
235 2586207758
236 2644372776
237 2644644397
238 2644682854
239 2738732234
240 2738760694
241 2738764799
242 2739213814
243 2739588006
244 2740001952
245 2740006768
246 2776612897
247 2802654531
248 2842724215
249 2849282527
250 2857617440
251 2857618862
252 2904420645
253 2904560040
254 2919686703
255 2929152313
256 2945998961
257 2954021413
258 2977270550
259 8055423746
260 8055592839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

1

115

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zvp-assembly1.cif.gz_A crystal structure of a protein of unknown function vc0802 from vibrio cholerae, possible transport protein 0.7754 107 138
1zvp-assembly2.cif.gz_B crystal structure of a protein of unknown function vc0802 from vibrio cholerae, possible transport protein 0.7732 107 138
3s6g-assembly1.cif.gz_A crystal structures of seleno-substituted mutant mmnags in space group p212121 0.6815 103 138
2was-assembly2.cif.gz_F structure of the fungal type i fas ppt domain 0.507 14 137
2wat-assembly2.cif.gz_F structure of the fungal type i fas ppt domain in complex with coa 0.5029 14 137
ID Description Score Start End Superfamily
1zvpB00 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.7732 107 138 3.30.2130.10
af_Q23353_103_173_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.556 102 138 3.90.1150.10
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.4805 7 137 3.90.470.20
4fxgC01 Mainly Beta;Sandwich;Immunoglobulin-like;Alpha-macroglobulin, receptor-binding domain 0.4693 107 138 2.60.40.690
af_Q8BZ10_44_151_3.30.70.960 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SEA domain 0.4512 24 106 3.30.70.960
ID Description Score Start End GO Terms
AF-A0A520I712-F1-model_v4 4'-phosphopantetheinyl transferase superfamily protein 0.8983 1 52 GO:0000287
GO:0008897
AF-A0A520I712-F1-model_v4 4'-phosphopantetheinyl transferase superfamily protein 0.8664 1 52 GO:0000287
GO:0008897
AF-A0A4Q3UAR7-F1-model_v4 4-phosphopantetheinyl transferase family protein 0.7076 7 137 GO:0000287
GO:0008897
AF-A0A519V7L0-F1-model_v4 4-phosphopantetheinyl transferase family protein 0.6129 7 137 GO:0000287
GO:0008897
AF-A0A354DAD8-F1-model_v4 deleted 0.6087 1 135

Map