F147265

General Info

Members Datasets Scaffolds Average Seq Length
130 107 260 279

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000307|Ga0500616_0000307_52245_53195
Length 316
Sequence MPRHARSRLGATPDATTQRCPGSSAGSAHRGADIREEGEMSTITTADGTEIYYKDWGEGRPVVLSHGWPLNADSWEAQMLFLASNGYRCIAHDRRGHGRSTQTWQGNDMDTYADDLAALIEALDLRDVTLIGFSTGGGEIARYVGHHGTDRVAQFVLVSAVPPLMVQRPDNPDGVPIDVFDGIRASSLADRSQTYHDLADGPFFGNNRPGADVSQGIRDAFWLQGLQSGARNAYECIKAFSETDFRPDLAKVDVPALVIHGDDDQVVPFAVAGRASAALIAGAELNVYPGAPHGITDTHKDQLGKDLLAFLESVPS

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
4 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
5 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
8 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
9 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
10 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
11 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
12 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
13 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
22 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
23 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
24 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
34 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
35 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
36 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
37 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
40 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
41 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
42 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
45 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
46 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
47 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
48 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
49 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
50 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
51 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
52 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
53 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
54 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
55 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
58 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
59 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
60 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
61 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
62 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
65 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
66 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
67 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
68 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
69 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
70 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
71 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
72 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
73 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
74 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
75 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
76 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
77 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
78 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
79 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
80 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
81 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
82 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
83 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
84 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
85 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
86 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
87 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
91 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
92 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
93 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
95 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
96 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
97 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
98 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
99 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
100 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
101 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
102 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
103 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
104 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
105 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
106 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
107 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.46
Nodule 0.77
Rhizoplane 3.85
Rhizosphere 73.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0000307 3300053153 Bacteria 70503
2 JGI25406J46586_10024682 3300003203 Bacteria 2350
3 Ga0070711_100337344 3300005439 Bacteria 1208
4 Ga0068859_100138747 3300005617 Bacteria 2505
5 Ga0081538_10047087 3300005981 Bacteria 2649
6 Ga0081539_10003785 3300005985 Bacteria 17869
7 Ga0075364_10285401 3300006051 Bacteria 1123
8 Ga0075367_10057465 3300006178 Bacteria 2313
9 Ga0068871_100230530 3300006358 Bacteria 1607
10 Ga0075428_100008952 3300006844 Bacteria 11107
11 Ga0075430_100390142 3300006846 Bacteria 1149
12 Ga0075431_100001766 3300006847 Bacteria 20371
13 Ga0075431_100331095 3300006847 Bacteria 1534
14 Ga0075433_10000789 3300006852 Bacteria 21919
15 Ga0075429_100009724 3300006880 Bacteria 8334
16 Ga0097620_100138746 3300006931 Bacteria 2505
17 Ga0111539_10018843 3300009094 Bacteria 8540
18 Ga0114129_10006292 3300009147 Bacteria 16830
19 Ga0114129_10007183 3300009147 Bacteria 15851
20 Ga0114129_10008538 3300009147 Bacteria 14603
21 Ga0114129_10039913 3300009147 Bacteria 6622
22 Ga0105248_10376674 3300009177 Bacteria 1598
23 Ga0157371_10000712 3300013102 Bacteria 38905
24 Ga0157374_10199050 3300013296 Bacteria 1961
25 Ga0163163_10031046 3300014325 Bacteria 5153
26 Ga0157379_10099435 3300014968 Bacteria 2612
27 Ga0209026_1001487 3300025250 Bacteria 10293
28 Ga0209564_1025566 3300025295 Bacteria 1980
29 Ga0207693_10090404 3300025915 Bacteria 2400
30 Ga0207691_10124346 3300025940 Bacteria 2283
31 Ga0207691_10550830 3300025940 Bacteria 978
32 Ga0207711_10094198 3300025941 Bacteria 2639
33 Ga0207661_10297184 3300025944 Bacteria 1447
34 Ga0207651_10056660 3300025960 Bacteria 2698
35 Ga0207703_10226103 3300026035 Bacteria 1675
36 Ga0265336_10002726 3300028666 Bacteria 7148
37 Ga0307515_10038624 3300028794 Bacteria 7628
38 Ga0265338_10048997 3300028800 Bacteria 3835
39 Ga0265338_10084638 3300028800 Bacteria 2646
40 Ga0265340_10000540 3300031247 Bacteria 20903
41 Ga0265340_10066256 3300031247 Bacteria 1719
42 Ga0265339_10086304 3300031249 Bacteria 1651
43 Ga0265327_10000039 3300031251 Bacteria 292334
44 Ga0265316_10018437 3300031344 Bacteria 5997
45 Ga0307513_10341869 3300031456 Bacteria 1247
46 Ga0265314_10000160 3300031711 Bacteria 102289
47 Ga0265342_10070744 3300031712 Bacteria 2034
48 Ga0307510_10033658 3300033180 Bacteria 5752
49 Ga0373934_0014992 3300035086 Bacteria 2939
50 Ga0395905_0058120 3300037471 Bacteria 3617
51 Ga0395905_0075051 3300037471 Bacteria 3169
52 Ga0436364_1238712 3300037853 Bacteria 18584
53 Ga0436361_0529902 3300039447 Bacteria 2605
54 Ga0436361_0544206 3300039447 Bacteria 1702
55 Ga0439436_0005581 3300041404 Bacteria 3856
56 Ga0439439_0010853 3300041406 Bacteria 2184
57 Ga0439447_020203 3300041407 Bacteria 1769
58 Ga0439465_0002859 3300041413 Bacteria 5654
59 Ga0451853_1267924 3300041512 Bacteria 4463
60 Ga0439431_0003156 3300041997 Bacteria 3622
61 Ga0439445_0016961 3300042004 Bacteria 1796
62 Ga0439452_001830 3300042010 Bacteria 8250
63 Ga0439434_0008892 3300042435 Bacteria 2951
64 Ga0439435_0009494 3300042436 Bacteria 2284
65 Ga0453684_0001435 3300044712 Bacteria 68004
66 Ga0495638_0184685 3300046460 Bacteria 1187
67 Ga0495650_0050487 3300046471 Bacteria 1719
68 Ga0495606_0004323 3300046507 Bacteria 14291
69 Ga0495620_0000149 3300046515 Bacteria 57195
70 Ga0495631_0000312 3300046518 Bacteria 33630
71 Ga0495632_0004197 3300046519 Bacteria 9851
72 Ga0495643_0014152 3300046522 Bacteria 4755
73 Ga0495613_0307653 3300046689 Bacteria 1096
74 Ga0495671_0046306 3300046692 Bacteria 2174
75 Ga0495674_0020950 3300047319 Bacteria 6049
76 Ga0495673_0001409 3300047469 Bacteria 19281
77 Ga0495686_0013902 3300047472 Bacteria 5570
78 Ga0496100_0062192 3300048903 Bacteria 2463
79 Ga0496101_0358840 3300048904 Bacteria 1146
80 Ga0496102_0355911 3300048905 Bacteria 1378
81 Ga0496106_0325746 3300048909 Bacteria 1233
82 Ga0496107_0487879 3300048910 Bacteria 914
83 Ga0496121_0019494 3300048924 Bacteria 6777
84 Ga0496122_0064621 3300048925 Bacteria 2661
85 Ga0496126_0043690 3300048929 Bacteria 4132
86 Ga0501070_0131166 3300049586 Bacteria 2070
87 Ga0501072_0434973 3300049588 Bacteria 1039
88 Ga0501074_0141523 3300049590 Bacteria 1721
89 Ga0501076_0031660 3300049592 Bacteria 4127
90 Ga0501079_0014743 3300049741 Bacteria 5958
91 Ga0501079_0406575 3300049741 Bacteria 1068
92 Ga0501083_0215356 3300049744 Bacteria 1252
93 Ga0501045_0341534 3300049824 Bacteria 1114
94 nmdc:mga03n38_243288_c1 3300050490 Bacteria 947
95 nmdc:mga03n38_3588_c1 3300050490 Bacteria 5012
96 nmdc:mga00v17_167181_c1 3300050491 Bacteria 1417
97 nmdc:mga00v17_82214_c1 3300050491 Bacteria 2012
98 nmdc:mga05p37_11082_c1 3300050507 Bacteria 10713
99 nmdc:mga05p37_147767_c1 3300050507 Bacteria 2877
100 nmdc:mga05p37_45714_c1 3300050507 Bacteria 5384
101 nmdc:mga05p37_52886_c1 3300050507 Bacteria 4995
102 nmdc:mga05p37_93663_c1 3300050507 Bacteria 3702
103 nmdc:mga09592_30774_c1 3300050508 Bacteria 4468
104 nmdc:mga09592_5240_c1 3300050508 Bacteria 10531
105 nmdc:mga06r32_166775_c1 3300050510 Bacteria 2185
106 nmdc:mga06r32_341317_c1 3300050510 Bacteria 1482
107 nmdc:mga06r32_36308_c1 3300050510 Bacteria 4656
108 nmdc:mga06r32_65985_c1 3300050510 Bacteria 3492
109 nmdc:mga0n895_154500_c1 3300050512 Bacteria 2325
110 nmdc:mga0rr50_11639_c1 3300050513 Bacteria 5642
111 nmdc:mga0rr50_21301_c1 3300050513 Bacteria 4422
112 nmdc:mga0a205_2186_c1 3300050515 Bacteria 17208
113 Ga0500644_0002480 3300053088 Bacteria 4613
114 Ga0500644_0020351 3300053088 Bacteria 1971
115 Ga0500622_0003564 3300053156 Bacteria 10287
116 Ga0501084_0247613 3300054114 Bacteria 1505
117 Ga0530510_0227183 3300061734 Bacteria 1388
118 2511391856 2511231027 Bacteria 5013807
119 2523468923 2523231067 Bacteria 5230452
120 2676481142 2675903059 Bacteria 8644972
121 2739351173 2738543031 Bacteria 5769731
122 2776269545 2775506902 Bacteria 6208009
123 2776282476 2775506904 Bacteria 5954060
124 2840766391 2840764183 Bacteria 6358399
125 2928522745 2928521798 Bacteria 4960112
126 2954013888 2954011201 Bacteria 4762601
127 3002141722 3002141150 Bacteria 5254435
128 642597432 642555112 Bacteria 8676562
129 8003317172 8003314358 Bacteria 10575343
130 8003319292 8003314358 Bacteria 10575343
131 Ga0500616_0000307
132 JGI25406J46586_10024682
133 Ga0070711_100337344
134 Ga0068859_100138747
135 Ga0081538_10047087
136 Ga0081539_10003785
137 Ga0075364_10285401
138 Ga0075367_10057465
139 Ga0068871_100230530
140 Ga0075428_100008952
141 Ga0075430_100390142
142 Ga0075431_100001766
143 Ga0075431_100331095
144 Ga0075433_10000789
145 Ga0075429_100009724
146 Ga0097620_100138746
147 Ga0111539_10018843
148 Ga0114129_10006292
149 Ga0114129_10007183
150 Ga0114129_10008538
151 Ga0114129_10039913
152 Ga0105248_10376674
153 Ga0157371_10000712
154 Ga0157374_10199050
155 Ga0163163_10031046
156 Ga0157379_10099435
157 Ga0209026_1001487
158 Ga0209564_1025566
159 Ga0207693_10090404
160 Ga0207691_10124346
161 Ga0207691_10550830
162 Ga0207711_10094198
163 Ga0207661_10297184
164 Ga0207651_10056660
165 Ga0207703_10226103
166 Ga0265336_10002726
167 Ga0307515_10038624
168 Ga0265338_10048997
169 Ga0265338_10084638
170 Ga0265340_10000540
171 Ga0265340_10066256
172 Ga0265339_10086304
173 Ga0265327_10000039
174 Ga0265316_10018437
175 Ga0307513_10341869
176 Ga0265314_10000160
177 Ga0265342_10070744
178 Ga0307510_10033658
179 Ga0373934_0014992
180 Ga0395905_0058120
181 Ga0395905_0075051
182 Ga0436364_1238712
183 Ga0436361_0529902
184 Ga0436361_0544206
185 Ga0439436_0005581
186 Ga0439439_0010853
187 Ga0439447_020203
188 Ga0439465_0002859
189 Ga0451853_1267924
190 Ga0439431_0003156
191 Ga0439445_0016961
192 Ga0439452_001830
193 Ga0439434_0008892
194 Ga0439435_0009494
195 Ga0453684_0001435
196 Ga0495638_0184685
197 Ga0495650_0050487
198 Ga0495606_0004323
199 Ga0495620_0000149
200 Ga0495631_0000312
201 Ga0495632_0004197
202 Ga0495643_0014152
203 Ga0495613_0307653
204 Ga0495671_0046306
205 Ga0495674_0020950
206 Ga0495673_0001409
207 Ga0495686_0013902
208 Ga0496100_0062192
209 Ga0496101_0358840
210 Ga0496102_0355911
211 Ga0496106_0325746
212 Ga0496107_0487879
213 Ga0496121_0019494
214 Ga0496122_0064621
215 Ga0496126_0043690
216 Ga0501070_0131166
217 Ga0501072_0434973
218 Ga0501074_0141523
219 Ga0501076_0031660
220 Ga0501079_0014743
221 Ga0501079_0406575
222 Ga0501083_0215356
223 Ga0501045_0341534
224 nmdc:mga03n38_243288_c1
225 nmdc:mga03n38_3588_c1
226 nmdc:mga00v17_167181_c1
227 nmdc:mga00v17_82214_c1
228 nmdc:mga05p37_11082_c1
229 nmdc:mga05p37_147767_c1
230 nmdc:mga05p37_45714_c1
231 nmdc:mga05p37_52886_c1
232 nmdc:mga05p37_93663_c1
233 nmdc:mga09592_30774_c1
234 nmdc:mga09592_5240_c1
235 nmdc:mga06r32_166775_c1
236 nmdc:mga06r32_341317_c1
237 nmdc:mga06r32_36308_c1
238 nmdc:mga06r32_65985_c1
239 nmdc:mga0n895_154500_c1
240 nmdc:mga0rr50_11639_c1
241 nmdc:mga0rr50_21301_c1
242 nmdc:mga0a205_2186_c1
243 Ga0500644_0002480
244 Ga0500644_0020351
245 Ga0500622_0003564
246 Ga0501084_0247613
247 Ga0530510_0227183
248 2511391856
249 2523468923
250 2676481142
251 2739351173
252 2776269545
253 2776282476
254 2840766391
255 2928522745
256 2954013888
257 3002141722
258 642597432
259 8003317172
260 8003319292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

60

300

0.92

PF12146

Hydrolase_4

Serine aminopeptidase, S33

59

177

0.92

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

62

304

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a8s-assembly1.cif.gz_A chloroperoxidase f/propionate complex 0.9911 2 273
3hi4-assembly2.cif.gz_D switching catalysis from hydrolysis to perhydrolysis in p. fluorescens esterase 0.9907 2 273
3hea-assembly1.cif.gz_A the l29p/l124i mutation of pseudomonas fluorescens esterase 0.9906 2 273
3ia2-assembly2.cif.gz_D pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog 0.9903 2 273
3t4u-assembly1.cif.gz_A l29i mutation in an aryl esterase from pseudomonas fluorescens leads to unique peptide flip and increased activity 0.9902 2 273
ID Description Score Start End Superfamily
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9897 3 273 3.40.50.1820
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9892 2 273 3.40.50.1820
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9856 2 273 3.40.50.1820
1a8qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9802 2 273 3.40.50.1820
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.979 3 273 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A699VHU6-F1-model_v4 Bifunctional epoxide hydrolase 2-like 1.003 1 76 GO:0016020
GO:0016787
AF-A2WIK9-F1-model_v4 deleted 0.9969 1 273
AF-A0A1H2HEA1-F1-model_v4 Non-heme chloroperoxidase 0.9969 3 273 GO:0004601
AF-B1N1N7-F1-model_v4 deleted 0.9958 1 273
AF-A0A7U7EG57-F1-model_v4 deleted 0.9957 3 273

Map