F149347

General Info

Members Datasets Scaffolds Average Seq Length
131 59 262 267

Family's Representative Sequence

Representative Sequence 3300025272|Ga0209455_1007555|Ga0209455_10075554
Length 290
Sequence LDYFAAYCPPLTHLLNYSFTVLYYDPIKRSLGNVFNRSPWLRRLFYHLLDLLLLRTWHVHRELRQWARGRTREPLQLLDAGAGYGQYSYWLSSLSSTWHILAVDVKDEQVKDSNDFFRAIGRPQVQFAVQDLVLYQEPNTFDLALSVDVMEHILEDVEVFRNIHTSLKDGGMLLISTPSDQGGSDVHDDSETSFIEEHVRDGYNIHEIQQKLRTAGFERIEAKYSYGEPGQISWRLSMKYPILLLGKSRWFFVLLPFYYLVVFPFCLLLNWLDARSTHDSGTGLIVKAWK

Samples

Sample ID Description Type Environment
1 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
4 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
5 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
6 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
7 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
8 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
9 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
10 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
11 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
12 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
13 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
14 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
15 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
20 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
21 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
22 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
23 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
24 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
25 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
26 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
27 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
28 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
29 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
30 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
31 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
32 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
33 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
34 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
35 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
36 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
37 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
38 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
39 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
40 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
41 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
42 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
43 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
44 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
45 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
46 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
47 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
48 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
50 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
51 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
54 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
56 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
57 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
58 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
59 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 0
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 11.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209455_1007555 3300025272 Bacteria 3054
2 Ga0070689_100120713 3300005340 Unclassified 2093
3 Ga0070685_10003506 3300005466 Bacteria 7982
4 Ga0068852_100020909 3300005616 Bacteria 5211
5 Ga0068859_100723567 3300005617 Unclassified 1085
6 Ga0068860_100039464 3300005843 Bacteria 4516
7 Ga0070712_100130460 3300006175 Unclassified 1904
8 Ga0097620_100723420 3300006931 Unclassified 1085
9 Ga0105242_10105722 3300009176 Bacteria 2391
10 Ga0105242_10112085 3300009176 Bacteria 2327
11 Ga0157371_10050605 3300013102 Bacteria 2952
12 Ga0157375_10116170 3300013308 Bacteria 2780
13 Ga0163163_10059079 3300014325 Bacteria 3792
14 Ga0157380_10000003 3300014326 Bacteria 224643
15 Ga0157376_10154470 3300014969 Unclassified 2073
16 Ga0207693_10149090 3300025915 Unclassified 1839
17 Ga0207686_10317348 3300025934 Bacteria 1163
18 Ga0207698_10115076 3300026142 Bacteria 2264
19 Ga0268264_10029147 3300028381 Bacteria 4520
20 Ga0265337_1026903 3300028556 Bacteria 1738
21 Ga0265338_10006195 3300028800 Bacteria 15333
22 Ga0265327_10002935 3300031251 Bacteria 17056
23 Ga0265327_10012745 3300031251 Bacteria 5644
24 Ga0265327_10033213 3300031251 Bacteria 2879
25 Ga0265316_10069846 3300031344 Bacteria 2710
26 Ga0265316_10100429 3300031344 Bacteria 2200
27 Ga0316579_10030888 3300031691 Bacteria 2450
28 Ga0265342_10170780 3300031712 Bacteria 1196
29 Ga0316576_10098313 3300031727 Bacteria 2185
30 Ga0316578_10012850 3300031728 Unclassified 4423
31 Ga0316578_10159044 3300031728 Unclassified 1361
32 Ga0316578_10203346 3300031728 Bacteria 1192
33 Ga0316577_10128438 3300031733 Unclassified 1426
34 Ga0316585_10052694 3300032137 Bacteria 1307
35 Ga0316580_10022904 3300032139 Bacteria 1928
36 Ga0316574_0054163 3300035398 Bacteria 2505
37 Ga0316574_0267789 3300035398 Unclassified 1090
38 Ga0373937_0272389 3300036401 Bacteria 1598
39 Ga0316582_0001632 3300036647 Bacteria 10015
40 Ga0316582_0078020 3300036647 Bacteria 2157
41 Ga0316584_0019230 3300036712 Unclassified 4936
42 Ga0316584_0081415 3300036712 Bacteria 2425
43 Ga0395899_0096835 3300037312 Bacteria 2134
44 Ga0395900_0016787 3300037418 Bacteria 7468
45 Ga0451577_0000037 3300042876 Bacteria 360162
46 Ga0451577_0000230 3300042876 Bacteria 113101
47 Ga0451577_0000548 3300042876 Bacteria 61415
48 Ga0451577_0005238 3300042876 Bacteria 13338
49 Ga0451577_0016530 3300042876 Bacteria 6831
50 Ga0451577_0017252 3300042876 Bacteria 6674
51 Ga0451577_0017579 3300042876 Bacteria 6606
52 Ga0451577_0028743 3300042876 Bacteria 5027
53 Ga0451577_0040917 3300042876 Bacteria 4161
54 Ga0451577_0057006 3300042876 Bacteria 3484
55 Ga0451577_0057409 3300042876 Bacteria 3470
56 Ga0451577_0088089 3300042876 Bacteria 2770
57 Ga0451577_0215692 3300042876 Bacteria 1734
58 Ga0451577_0541525 3300042876 Unclassified 1057
59 Ga0453683_0000021 3300044673 Bacteria 284502
60 Ga0453683_0000085 3300044673 Bacteria 140003
61 Ga0453683_0000092 3300044673 Bacteria 136648
62 Ga0453683_0000325 3300044673 Bacteria 58597
63 Ga0453683_0002954 3300044673 Bacteria 12776
64 Ga0453683_0005520 3300044673 Bacteria 8815
65 Ga0453683_0017896 3300044673 Bacteria 4554
66 Ga0453683_0031807 3300044673 Bacteria 3332
67 Ga0453683_0059725 3300044673 Bacteria 2384
68 Ga0453683_0063529 3300044673 Bacteria 2308
69 Ga0453683_0099135 3300044673 Bacteria 1829
70 Ga0453683_0109089 3300044673 Bacteria 1740
71 Ga0453683_0202815 3300044673 Bacteria 1259
72 Ga0453684_0000110 3300044712 Bacteria 360542
73 Ga0453684_0000337 3300044712 Bacteria 195296
74 Ga0453684_0000340 3300044712 Bacteria 194264
75 Ga0453684_0000497 3300044712 Bacteria 153728
76 Ga0453684_0000616 3300044712 Bacteria 130153
77 Ga0453684_0000759 3300044712 Bacteria 112043
78 Ga0453684_0000766 3300044712 Bacteria 111429
79 Ga0453684_0004644 3300044712 Bacteria 28544
80 Ga0453684_0007470 3300044712 Bacteria 20069
81 Ga0453684_0008327 3300044712 Bacteria 18650
82 Ga0453684_0008988 3300044712 Bacteria 17648
83 Ga0453684_0024748 3300044712 Bacteria 8752
84 Ga0453684_0029560 3300044712 Bacteria 7776
85 Ga0453684_0029756 3300044712 Bacteria 7740
86 Ga0453684_0057529 3300044712 Bacteria 5032
87 Ga0453684_0084741 3300044712 Unclassified 3940
88 Ga0453684_0094314 3300044712 Bacteria 3682
89 Ga0453684_0128962 3300044712 Bacteria 3038
90 Ga0453684_0153427 3300044712 Bacteria 2734
91 Ga0453684_0157676 3300044712 Bacteria 2689
92 Ga0453684_0191299 3300044712 Bacteria 2394
93 Ga0453684_0192585 3300044712 Bacteria 2384
94 Ga0453684_0402167 3300044712 Bacteria 1533
95 Ga0453684_0841233 3300044712 Unclassified 987
96 Ga0451576_0000039 3300045051 Bacteria 360162
97 Ga0451576_0000093 3300045051 Bacteria 226300
98 Ga0451576_0000264 3300045051 Bacteria 128283
99 Ga0451576_0000346 3300045051 Bacteria 112037
100 Ga0451576_0000639 3300045051 Bacteria 72715
101 Ga0451576_0000683 3300045051 Bacteria 69004
102 Ga0451576_0001907 3300045051 Bacteria 33418
103 Ga0451576_0004025 3300045051 Bacteria 19542
104 Ga0451576_0006480 3300045051 Bacteria 14344
105 Ga0451576_0032815 3300045051 Bacteria 5522
106 Ga0451576_0034410 3300045051 Bacteria 5381
107 Ga0451576_0087621 3300045051 Bacteria 3238
108 Ga0451576_0235178 3300045051 Bacteria 1913
109 Ga0451576_0267396 3300045051 Bacteria 1787
110 Ga0451576_0906616 3300045051 Bacteria 925
111 Ga0495652_0298908 3300046529 Bacteria 1171
112 Ga0495640_0094991 3300046533 Unclassified 1963
113 Ga0495680_0029014 3300047322 Bacteria 4534
114 Ga0501031_0000249 3300049568 Bacteria 30234
115 Ga0501032_0002030 3300049569 Bacteria 15972
116 Ga0501032_0141827 3300049569 Bacteria 1582
117 Ga0501033_0000004 3300049570 Bacteria 441310
118 Ga0501034_0001804 3300049571 Bacteria 27281
119 Ga0501036_0002845 3300049572 Bacteria 13717
120 Ga0501037_0049165 3300049573 Bacteria 3088
121 Ga0501038_0001517 3300049574 Bacteria 21376
122 Ga0501039_0001415 3300049575 Bacteria 17662
123 Ga0501043_0001976 3300049579 Bacteria 17491
124 Ga0501048_0053622 3300049582 Bacteria 2867
125 Ga0501035_0002702 3300049822 Bacteria 17241
126 Ga0501044_0002271 3300049823 Bacteria 21924
127 Ga0501045_0000002 3300049824 Bacteria 94022
128 Ga0500618_001800 3300053125 Bacteria 9033
129 2740032024 2739367866 Bacteria 4215900
130 2839990623 2839989709 Bacteria 3773432
131 2910250547 2910245624 Bacteria 6935613
132 Ga0209455_1007555
133 Ga0070689_100120713
134 Ga0070685_10003506
135 Ga0068852_100020909
136 Ga0068859_100723567
137 Ga0068860_100039464
138 Ga0070712_100130460
139 Ga0097620_100723420
140 Ga0105242_10105722
141 Ga0105242_10112085
142 Ga0157371_10050605
143 Ga0157375_10116170
144 Ga0163163_10059079
145 Ga0157380_10000003
146 Ga0157376_10154470
147 Ga0207693_10149090
148 Ga0207686_10317348
149 Ga0207698_10115076
150 Ga0268264_10029147
151 Ga0265337_1026903
152 Ga0265338_10006195
153 Ga0265327_10002935
154 Ga0265327_10012745
155 Ga0265327_10033213
156 Ga0265316_10069846
157 Ga0265316_10100429
158 Ga0316579_10030888
159 Ga0265342_10170780
160 Ga0316576_10098313
161 Ga0316578_10012850
162 Ga0316578_10159044
163 Ga0316578_10203346
164 Ga0316577_10128438
165 Ga0316585_10052694
166 Ga0316580_10022904
167 Ga0316574_0054163
168 Ga0316574_0267789
169 Ga0373937_0272389
170 Ga0316582_0001632
171 Ga0316582_0078020
172 Ga0316584_0019230
173 Ga0316584_0081415
174 Ga0395899_0096835
175 Ga0395900_0016787
176 Ga0451577_0000037
177 Ga0451577_0000230
178 Ga0451577_0000548
179 Ga0451577_0005238
180 Ga0451577_0016530
181 Ga0451577_0017252
182 Ga0451577_0017579
183 Ga0451577_0028743
184 Ga0451577_0040917
185 Ga0451577_0057006
186 Ga0451577_0057409
187 Ga0451577_0088089
188 Ga0451577_0215692
189 Ga0451577_0541525
190 Ga0453683_0000021
191 Ga0453683_0000085
192 Ga0453683_0000092
193 Ga0453683_0000325
194 Ga0453683_0002954
195 Ga0453683_0005520
196 Ga0453683_0017896
197 Ga0453683_0031807
198 Ga0453683_0059725
199 Ga0453683_0063529
200 Ga0453683_0099135
201 Ga0453683_0109089
202 Ga0453683_0202815
203 Ga0453684_0000110
204 Ga0453684_0000337
205 Ga0453684_0000340
206 Ga0453684_0000497
207 Ga0453684_0000616
208 Ga0453684_0000759
209 Ga0453684_0000766
210 Ga0453684_0004644
211 Ga0453684_0007470
212 Ga0453684_0008327
213 Ga0453684_0008988
214 Ga0453684_0024748
215 Ga0453684_0029560
216 Ga0453684_0029756
217 Ga0453684_0057529
218 Ga0453684_0084741
219 Ga0453684_0094314
220 Ga0453684_0128962
221 Ga0453684_0153427
222 Ga0453684_0157676
223 Ga0453684_0191299
224 Ga0453684_0192585
225 Ga0453684_0402167
226 Ga0453684_0841233
227 Ga0451576_0000039
228 Ga0451576_0000093
229 Ga0451576_0000264
230 Ga0451576_0000346
231 Ga0451576_0000639
232 Ga0451576_0000683
233 Ga0451576_0001907
234 Ga0451576_0004025
235 Ga0451576_0006480
236 Ga0451576_0032815
237 Ga0451576_0034410
238 Ga0451576_0087621
239 Ga0451576_0235178
240 Ga0451576_0267396
241 Ga0451576_0906616
242 Ga0495652_0298908
243 Ga0495640_0094991
244 Ga0495680_0029014
245 Ga0501031_0000249
246 Ga0501032_0002030
247 Ga0501032_0141827
248 Ga0501033_0000004
249 Ga0501034_0001804
250 Ga0501036_0002845
251 Ga0501037_0049165
252 Ga0501038_0001517
253 Ga0501039_0001415
254 Ga0501043_0001976
255 Ga0501048_0053622
256 Ga0501035_0002702
257 Ga0501044_0002271
258 Ga0501045_0000002
259 Ga0500618_001800
260 2740032024
261 2839990623
262 2910250547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

77

171

0.91

PF08241

Methyltransf_11

Methyltransferase domain

78

175

0.91

PF08242

Methyltransf_12

Methyltransferase domain

78

173

0.87

PF13847

Methyltransf_31

Methyltransferase domain

72

220

0.84

PF13489

Methyltransf_23

Methyltransferase domain

47

222

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hgy-assembly1.cif.gz_E structure of the ccbj methyltransferase from streptomyces caelestis 0.9108 53 160
7phf-assembly2.cif.gz_C chimeric carminomycin-4-o-methyltransferase (dnrk) with regions from 10-hydroxylase rdmb and 10-decarboxylase tamk 0.8892 53 154
7wm6-assembly1.cif.gz_B crystal structure of sah-bound trmm from mycoplasma capricolum 0.8685 52 202
8d58-assembly1.cif.gz_A crystal structure of human mettl1-wdr4 complex 0.8663 52 155
7phf-assembly2.cif.gz_D chimeric carminomycin-4-o-methyltransferase (dnrk) with regions from 10-hydroxylase rdmb and 10-decarboxylase tamk 0.8538 53 160
ID Description Score Start End Superfamily
af_A0A1D6I0D9_80_215_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8889 52 153 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8832 41 153 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8803 54 111 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.873 50 109 3.40.50.150
af_Q55EX4_556_743_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.869 52 155 3.40.50.150
ID Description Score Start End GO Terms
AF-B9TMB8-F1-model_v4 Methyltransferase 0.9192 51 151 GO:0008168
AF-A0A6N9NDM7-F1-model_v4 Methyltransferase domain-containing protein 0.9184 1 268 GO:0008168
GO:0016020
GO:0032259
AF-A0A6N9NDM7-F1-model_v4 Methyltransferase domain-containing protein 0.9151 1 268 GO:0008168
GO:0016020
GO:0032259
AF-A0A5L4KDC5-F1-model_v4 Class I SAM-dependent methyltransferase 0.903 49 143 GO:0008168
GO:0032259
AF-A0A1W7R8X4-F1-model_v4 Putative glutathione s-transferase inal domain-containing protein 0.9028 46 122 GO:0005737
GO:0016740

Map