F150720

General Info

Members Datasets Scaffolds Average Seq Length
131 114 262 249

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_51048_c1|nmdc:mga03683_51048_c1_718_1581
Length 287
Sequence LRAFRDPLVGLAAQLTDLPSENDVFLKSANPGENGGVMKDAQSNSKVAIVTGSSRGIGAAIAKRLAADGFTIIVNYAGRAADAEQVVQAIGEAGGKAAAIQADVSAPAEVAALFDRTETLFGGVDVLVNNAGIIQPGLVPLSETDDALFDRLLAVNLKGVFNALRVASKRLRPGGRIVNFSTSVVGLALPGYSIYAATKAAVETLTNIFAKELRGRNITVNAVAPGPTATDLFFTGKTEEQIAHLTKMAPLERLGKPEDIAGVVSFLAGPDGGWVNGQTLRANGGIV

Samples

Sample ID Description Type Environment
1 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
32 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
34 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
35 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
36 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
37 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
38 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
51 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
52 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
62 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
63 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
64 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
65 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
66 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
67 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
68 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
69 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
70 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
71 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
72 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
73 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
74 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
75 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
76 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
77 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
78 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
79 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
80 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
81 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
82 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
83 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
84 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
85 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
86 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
89 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
90 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
91 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
92 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
93 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
94 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
95 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
96 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
97 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
98 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
99 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
100 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
101 2738541297 Duganella sp. GV083 Isolate Unclassified
102 2738541357 Duganella sp. GV053 Isolate Unclassified
103 2738543003 Duganella sp. GV066 Isolate Unclassified
104 2738543026 Duganella sp. GV089 Isolate Unclassified
105 2738543029 Duganella sp. GV039 Isolate Unclassified
106 2791355262 Rhizobium sp. M1 Isolate Nodule
107 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
108 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
109 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
110 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
111 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
112 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
113 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
114 2941471342 Luteibacter sp. 621 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.02
Metatranscriptomes 0
Isolates 12.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.56
Nodule 0.76
Rhizoplane 1.53
Rhizosphere 46.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03683_51048_c1 3300050489 Bacteria 1725
2 JGI24736J21556_1020412 3300001904 Bacteria 1041
3 JGI25155J39150_1000007 3300002704 Bacteria 238857
4 JGI25156J39149_1000050 3300002705 Bacteria 89634
5 JGI25162J39368_1000908 3300002737 Bacteria 19122
6 JGI25154J39366_1000035 3300002738 Bacteria 172224
7 JGI25157J39369_1000036 3300002741 Bacteria 133671
8 rootH1_10021276 3300003316 Bacteria 2697
9 rootL2_10052043 3300003322 Bacteria 3812
10 Ga0055524_1023305 3300003775 Bacteria 1997
11 Ga0055528_1000525 3300003790 Bacteria 29704
12 Ga0070658_10026243 3300005327 Bacteria 4673
13 Ga0070709_10188879 3300005434 Bacteria 1452
14 Ga0070710_10107260 3300005437 Bacteria 1672
15 Ga0070710_10311413 3300005437 Bacteria 1031
16 Ga0070711_100166153 3300005439 Bacteria 1677
17 Ga0070663_100377837 3300005455 Bacteria 1153
18 Ga0068853_100000034 3300005539 Bacteria 113508
19 Ga0070665_100173510 3300005548 Bacteria 2157
20 Ga0068855_100715753 3300005563 Bacteria 1070
21 Ga0068858_100407857 3300005842 Bacteria 1306
22 Ga0081540_1000785 3300005983 Bacteria 29131
23 Ga0081539_10008815 3300005985 Bacteria 8634
24 Ga0075369_10034292 3300006186 Bacteria 2154
25 Ga0105243_10151146 3300009148 Bacteria 1992
26 Ga0105238_10023208 3300009551 Bacteria 6324
27 Ga0157370_10040195 3300013104 Bacteria 4516
28 Ga0157369_10008814 3300013105 Bacteria 11557
29 Ga0163163_10443893 3300014325 Bacteria 1357
30 Ga0163161_10040505 3300017792 Bacteria 3346
31 Ga0163161_10042330 3300017792 Bacteria 3275
32 Ga0213876_10027499 3300021384 Bacteria 3000
33 Ga0209435_100005 3300025206 Bacteria 573745
34 Ga0209760_104870 3300025207 Bacteria 1132
35 Ga0209437_100058 3300025233 Bacteria 357279
36 Ga0209646_1000011 3300025246 Bacteria 573745
37 Ga0209026_1000008 3300025250 Bacteria 573745
38 Ga0209026_1003228 3300025250 Bacteria 5492
39 Ga0209759_1000004 3300025256 Bacteria 573745
40 Ga0209233_1000240 3300025261 Bacteria 90758
41 Ga0209673_1000478 3300025273 Bacteria 66832
42 Ga0209564_1000215 3300025295 Bacteria 132838
43 Ga0209256_1000155 3300025299 Bacteria 144379
44 Ga0209051_1008707 3300025303 Bacteria 5337
45 Ga0207647_10000014 3300025904 Bacteria 143525
46 Ga0207707_10356685 3300025912 Bacteria 1259
47 Ga0207693_10092398 3300025915 Bacteria 2372
48 Ga0207709_10107264 3300025935 Bacteria 1859
49 Ga0207665_10010767 3300025939 Bacteria 6004
50 Ga0207639_10000052 3300026041 Bacteria 113608
51 Ga0209371_1003295 3300027312 Bacteria 7996
52 Ga0268266_10000750 3300028379 Bacteria 43429
53 Ga0268266_10158698 3300028379 Bacteria 2045
54 Ga0307515_10115213 3300028794 Bacteria 3099
55 Ga0268256_1002990 3300030500 Bacteria 7996
56 Ga0307511_10003392 3300030521 Bacteria 16378
57 Ga0307513_10022431 3300031456 Bacteria 7423
58 Ga0307514_10002130 3300031649 Bacteria 21362
59 Ga0265314_10019679 3300031711 Bacteria 5224
60 Ga0307410_10484800 3300031852 Bacteria 1015
61 Ga0316582_0059335 3300036647 Bacteria 2450
62 Ga0373925_0319398 3300037068 Bacteria 1256
63 Ga0395901_0237271 3300038443 Bacteria 1903
64 Ga0436365_0737124 3300039437 Bacteria 3072
65 Ga0436361_0299846 3300039447 Bacteria 2122
66 Ga0453683_0000500 3300044673 Bacteria 44816
67 Ga0495606_0000129 3300046507 Bacteria 127929
68 Ga0495606_0000419 3300046507 Bacteria 71128
69 Ga0495606_0006520 3300046507 Bacteria 10740
70 Ga0495606_0029194 3300046507 Bacteria 3877
71 Ga0495606_0245473 3300046507 Bacteria 996
72 Ga0495610_0000086 3300046512 Bacteria 109119
73 Ga0495610_0019739 3300046512 Bacteria 3759
74 Ga0495643_0000118 3300046522 Bacteria 127939
75 Ga0495597_0007732 3300046542 Bacteria 5434
76 Ga0495633_0002024 3300046558 Bacteria 14637
77 Ga0495611_0030057 3300046648 Bacteria 2387
78 Ga0495625_0001716 3300046660 Bacteria 25479
79 Ga0495671_0028717 3300046692 Bacteria 2862
80 Ga0495649_0069137 3300046694 Bacteria 1894
81 Ga0495672_0000253 3300047320 Bacteria 74560
82 Ga0495677_0026646 3300047445 Bacteria 2096
83 Ga0495686_0014472 3300047472 Bacteria 5426
84 Ga0496106_0108491 3300048909 Bacteria 2159
85 Ga0496117_0007624 3300048920 Bacteria 10508
86 Ga0496117_0010079 3300048920 Bacteria 8676
87 Ga0496118_0000268 3300048921 Bacteria 91201
88 Ga0496120_0067515 3300048923 Bacteria 1975
89 Ga0496121_0000116 3300048924 Bacteria 177260
90 Ga0496121_0000729 3300048924 Bacteria 60664
91 Ga0496121_0464462 3300048924 Bacteria 812
92 Ga0496122_0117019 3300048925 Bacteria 1731
93 Ga0496122_0167255 3300048925 Bacteria 1331
94 Ga0496123_0038520 3300048926 Bacteria 3358
95 Ga0496123_0050992 3300048926 Bacteria 2760
96 Ga0496124_0325439 3300048927 Bacteria 1099
97 Ga0496125_0003171 3300048928 Bacteria 20382
98 Ga0496126_0001112 3300048929 Bacteria 45021
99 Ga0496126_0117410 3300048929 Bacteria 2311
100 Ga0495678_000425 3300049459 Bacteria 42463
101 Ga0501048_0182665 3300049582 Bacteria 1487
102 Ga0501080_0026066 3300049742 Bacteria 5430
103 Ga0501080_0026929 3300049742 Bacteria 5346
104 nmdc:mga0sz30_64333_c1 3300050516 Bacteria 1571
105 Ga0500646_0001818 3300053090 Bacteria 5607
106 Ga0500583_0002816 3300053092 Bacteria 5330
107 Ga0500583_0134203 3300053092 Bacteria 1228
108 Ga0500593_000110 3300053117 Bacteria 31668
109 Ga0500594_0046328 3300053118 Bacteria 1209
110 Ga0500614_058866 3300053123 Bacteria 1028
111 Ga0500559_0006705 3300053136 Bacteria 5171
112 Ga0500586_000055 3300053145 Bacteria 20071
113 Ga0500604_0000094 3300053151 Bacteria 28414
114 Ga0500637_0053567 3300053178 Bacteria 2303
115 2516019671 2515154189 Bacteria 9629850
116 2521557202 2521172590 Bacteria 5047645
117 2601670150 2600255292 Bacteria 6300551
118 2738825821 2738541297 Bacteria 6549566
119 2739149618 2738541357 Bacteria 6549408
120 2739191537 2738543003 Bacteria 6549560
121 2739318014 2738543026 Bacteria 6549408
122 2739336255 2738543029 Bacteria 6549249
123 2793335033 2791355262 Bacteria 6774204
124 2819617829 2818991449 Bacteria 5518009
125 2857553121 2857547612 Bacteria 6179999
126 2883092116 2883087390 Bacteria 9532701
127 2919047685 2919046199 Bacteria 5567169
128 2929143692 2929138655 Bacteria 5810547
129 2932413662 2932410948 Bacteria 6312192
130 2932417722 2932416698 Bacteria 6315112
131 2941471973 2941471342 Bacteria 5018624
132 nmdc:mga03683_51048_c1
133 JGI24736J21556_1020412
134 JGI25155J39150_1000007
135 JGI25156J39149_1000050
136 JGI25162J39368_1000908
137 JGI25154J39366_1000035
138 JGI25157J39369_1000036
139 rootH1_10021276
140 rootL2_10052043
141 Ga0055524_1023305
142 Ga0055528_1000525
143 Ga0070658_10026243
144 Ga0070709_10188879
145 Ga0070710_10107260
146 Ga0070710_10311413
147 Ga0070711_100166153
148 Ga0070663_100377837
149 Ga0068853_100000034
150 Ga0070665_100173510
151 Ga0068855_100715753
152 Ga0068858_100407857
153 Ga0081540_1000785
154 Ga0081539_10008815
155 Ga0075369_10034292
156 Ga0105243_10151146
157 Ga0105238_10023208
158 Ga0157370_10040195
159 Ga0157369_10008814
160 Ga0163163_10443893
161 Ga0163161_10040505
162 Ga0163161_10042330
163 Ga0213876_10027499
164 Ga0209435_100005
165 Ga0209760_104870
166 Ga0209437_100058
167 Ga0209646_1000011
168 Ga0209026_1000008
169 Ga0209026_1003228
170 Ga0209759_1000004
171 Ga0209233_1000240
172 Ga0209673_1000478
173 Ga0209564_1000215
174 Ga0209256_1000155
175 Ga0209051_1008707
176 Ga0207647_10000014
177 Ga0207707_10356685
178 Ga0207693_10092398
179 Ga0207709_10107264
180 Ga0207665_10010767
181 Ga0207639_10000052
182 Ga0209371_1003295
183 Ga0268266_10000750
184 Ga0268266_10158698
185 Ga0307515_10115213
186 Ga0268256_1002990
187 Ga0307511_10003392
188 Ga0307513_10022431
189 Ga0307514_10002130
190 Ga0265314_10019679
191 Ga0307410_10484800
192 Ga0316582_0059335
193 Ga0373925_0319398
194 Ga0395901_0237271
195 Ga0436365_0737124
196 Ga0436361_0299846
197 Ga0453683_0000500
198 Ga0495606_0000129
199 Ga0495606_0000419
200 Ga0495606_0006520
201 Ga0495606_0029194
202 Ga0495606_0245473
203 Ga0495610_0000086
204 Ga0495610_0019739
205 Ga0495643_0000118
206 Ga0495597_0007732
207 Ga0495633_0002024
208 Ga0495611_0030057
209 Ga0495625_0001716
210 Ga0495671_0028717
211 Ga0495649_0069137
212 Ga0495672_0000253
213 Ga0495677_0026646
214 Ga0495686_0014472
215 Ga0496106_0108491
216 Ga0496117_0007624
217 Ga0496117_0010079
218 Ga0496118_0000268
219 Ga0496120_0067515
220 Ga0496121_0000116
221 Ga0496121_0000729
222 Ga0496121_0464462
223 Ga0496122_0117019
224 Ga0496122_0167255
225 Ga0496123_0038520
226 Ga0496123_0050992
227 Ga0496124_0325439
228 Ga0496125_0003171
229 Ga0496126_0001112
230 Ga0496126_0117410
231 Ga0495678_000425
232 Ga0501048_0182665
233 Ga0501080_0026066
234 Ga0501080_0026929
235 nmdc:mga0sz30_64333_c1
236 Ga0500646_0001818
237 Ga0500583_0002816
238 Ga0500583_0134203
239 Ga0500593_000110
240 Ga0500594_0046328
241 Ga0500614_058866
242 Ga0500559_0006705
243 Ga0500586_000055
244 Ga0500604_0000094
245 Ga0500637_0053567
246 2516019671
247 2521557202
248 2601670150
249 2738825821
250 2739149618
251 2739191537
252 2739318014
253 2739336255
254 2793335033
255 2819617829
256 2857553121
257 2883092116
258 2919047685
259 2929143692
260 2932413662
261 2932417722
262 2941471973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

46

241

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

52

287

0.94

PF08659

KR

KR domain

47

228

0.89

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

48

256

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u5t-assembly3.cif.gz_B the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti 0.9892 8 247
3u5t-assembly1.cif.gz_A the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti 0.9883 8 247
3u5t-assembly3.cif.gz_D the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti 0.9881 8 247
3u5t-assembly3.cif.gz_D the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti 0.9838 8 247
3u5t-assembly1.cif.gz_C the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti 0.9812 10 247
ID Description Score Start End Superfamily
af_A0A1P8BDP1_1_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9799 5 233 3.40.50.720
3u5tC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9765 10 247 3.40.50.720
3u5tC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9674 10 247 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9649 8 247 3.40.50.720
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.961 5 245 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0F9MQQ7-F1-model_v4 Uncharacterized protein 0.995 7 193 GO:0016614
AF-A0A401YET2-F1-model_v4 3-ketoacyl-ACP reductase 0.9921 8 247 GO:0016614
AF-A0A1H9FRT4-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9919 8 247 GO:0016614
AF-A0A2S1LAK3-F1-model_v4 3-ketoacyl-ACP reductase 0.9919 7 247 GO:0016614
AF-A0A542SYY9-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9915 8 247 GO:0016614

Map