F153173

General Info

Members Datasets Scaffolds Average Seq Length
132 100 264 399

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10008455|Ga0265318_100084552
Length 425
Sequence MLYYLFMYLKKEFNLPGAGVFQYISFRAALAVILSLLISMVFGRKIIHYLRKKQIGETVRDLGLDGEKTKQGTPTMGGFIILSGILIPTLLFARLANVYIIIMIVTTVWLGLIGFIDDYIKVFKKDKAGLAGRFKILGQIGLGIIIGCTLYFNPYVIVREKMASSEEIKVVRGETKNIIDDMRRNENYLYSPENIKATKTTIPFYKNNEFDYASLLSWLGPNYKNYAWIIFIPIVILIITAVSNGANITDGIDGLATGTSAIIGATLGILAYVSGNVVFANYLNIMYIPNTGELVIFIAAFVGACVGFLWYNAYPAQVFMGDTGSLALGGIIATFAIAIRKELLIPILCGIFFIENLSVVMQVSYFKYQKRKKGIEYAREHRLFRMSPLHHHFQKKGYHESKIVTRFLIIGIMLAIVTIVTLKLR

Samples

Sample ID Description Type Environment
1 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
16 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
19 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
20 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
31 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
33 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
39 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
40 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
41 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
42 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
43 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
46 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
47 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
53 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
54 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
55 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
56 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
57 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
58 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
59 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
60 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
61 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
62 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
63 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
64 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
65 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
66 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
67 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
68 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
69 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
70 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
71 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
72 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
74 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
75 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
76 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
77 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
78 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
79 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
80 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
81 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
82 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
83 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
84 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
85 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
86 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
87 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
88 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
89 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
90 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
91 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
92 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
93 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
94 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
95 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
96 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
97 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
98 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
99 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
100 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.58
Metatranscriptomes 0
Isolates 17.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.39
Nodule 0
Rhizoplane 0.76
Rhizosphere 65.91
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265318_10008455 3300028577 Bacteria 4581
2 JGI24739J22299_10000475 3300001989 Bacteria 14127
3 rootL2_10080210 3300003322 Bacteria 2534
4 rootL2_10080211 3300003322 Bacteria 4800
5 JGI25160J50197_1003022 3300003354 Bacteria 7664
6 Ga0055526_1010110 3300003771 Bacteria 4429
7 Ga0055526_1014782 3300003771 Bacteria 3182
8 Ga0055528_1000463 3300003790 Bacteria 32439
9 Ga0055530_10000261 3300003791 Bacteria 47614
10 Ga0055543_1011252 3300004625 Bacteria 1840
11 Ga0065165_1000148 3300005262 Bacteria 122640
12 Ga0065714_10067310 3300005288 Bacteria 5667
13 Ga0065704_10072462 3300005289 Bacteria 8466
14 Ga0065704_10118732 3300005289 Bacteria 1812
15 Ga0070689_100048188 3300005340 Bacteria 3286
16 Ga0070685_10006994 3300005466 Bacteria 5757
17 Ga0105244_10000508 3300009036 Bacteria 34770
18 Ga0105241_10182463 3300009174 Bacteria 1742
19 Ga0105242_10048034 3300009176 Bacteria 3467
20 Ga0105239_10062430 3300010375 Bacteria 4089
21 Ga0157373_10000038 3300013100 Bacteria 121372
22 Ga0157371_10014250 3300013102 Bacteria 6010
23 Ga0157370_10000573 3300013104 Bacteria 45919
24 Ga0157370_10005833 3300013104 Bacteria 13761
25 Ga0157370_10017853 3300013104 Bacteria 7150
26 Ga0157370_10063258 3300013104 Bacteria 3506
27 Ga0157369_10000402 3300013105 Bacteria 57623
28 Ga0163162_10202248 3300013306 Bacteria 2115
29 Ga0157372_10000026 3300013307 Bacteria 195407
30 Ga0157372_10001702 3300013307 Bacteria 23833
31 Ga0157372_10005143 3300013307 Bacteria 13905
32 Ga0157375_10006520 3300013308 Bacteria 10157
33 Ga0157380_10000065 3300014326 Bacteria 60148
34 Ga0182006_1004174 3300015261 Bacteria 7172
35 Ga0163161_10000083 3300017792 Bacteria 94571
36 Ga0163161_10000694 3300017792 Bacteria 26829
37 Ga0163161_10028042 3300017792 Bacteria 3997
38 Ga0209673_1000543 3300025273 Bacteria 61360
39 Ga0209564_1004627 3300025295 Bacteria 8284
40 Ga0209564_1008871 3300025295 Bacteria 4890
41 Ga0209758_1004190 3300025297 Bacteria 12246
42 Ga0209758_1011437 3300025297 Bacteria 5143
43 Ga0209050_1000359 3300025298 Bacteria 87723
44 Ga0207426_1000752 3300025302 Bacteria 36280
45 Ga0209257_1004378 3300025304 Bacteria 10987
46 Ga0207655_1000045 3300025728 Bacteria 315397
47 Ga0207690_10010138 3300025932 Bacteria 5596
48 Ga0207709_10000007 3300025935 Bacteria 752025
49 Ga0207670_10034104 3300025936 Bacteria 3286
50 Ga0265334_10031529 3300028573 Bacteria 2118
51 Ga0307515_10222504 3300028794 Bacteria 1701
52 Ga0316177_1019498 3300030731 Bacteria 7221
53 Ga0316183_1115618 3300030742 Bacteria 53789
54 Ga0316181_1088948 3300030744 Bacteria 14104
55 Ga0265327_10002725 3300031251 Bacteria 18043
56 Ga0265327_10003577 3300031251 Bacteria 14692
57 Ga0307408_100000572 3300031548 Bacteria 31757
58 Ga0316576_10063053 3300031727 Bacteria 2720
59 Ga0307414_10000137 3300032004 Bacteria 49784
60 Ga0307414_10001209 3300032004 Bacteria 13311
61 Ga0307414_10046954 3300032004 Bacteria 2968
62 Ga0307510_10014167 3300033180 Bacteria 9441
63 Ga0395899_0000040 3300037312 Bacteria 261561
64 Ga0395899_0000055 3300037312 Bacteria 220579
65 Ga0395899_0047563 3300037312 Bacteria 3194
66 Ga0395900_0103859 3300037418 Bacteria 2919
67 Ga0395905_0000001 3300037471 Bacteria 2037079
68 Ga0395905_0001738 3300037471 Bacteria 25476
69 Ga0395901_0003573 3300038443 Bacteria 15682
70 Ga0400483_217432 3300039062 Bacteria 35275
71 Ga0400489_31646 3300039093 Bacteria 6770
72 Ga0451577_0000249 3300042876 Bacteria 106109
73 Ga0451577_0012837 3300042876 Bacteria 7863
74 Ga0451577_0074010 3300042876 Bacteria 3039
75 Ga0451577_0094553 3300042876 Bacteria 2669
76 Ga0453684_0006896 3300044712 Bacteria 21300
77 Ga0453684_0011621 3300044712 Bacteria 14705
78 Ga0453684_0030203 3300044712 Bacteria 7663
79 Ga0453684_0082227 3300044712 Bacteria 4013
80 Ga0453684_0090390 3300044712 Bacteria 3783
81 Ga0453684_0109557 3300044712 Bacteria 3358
82 Ga0453684_0233949 3300044712 Bacteria 2119
83 Ga0451576_0000003 3300045051 Bacteria 1550573
84 Ga0451576_0084463 3300045051 Bacteria 3303
85 Ga0451576_0092054 3300045051 Bacteria 3154
86 Ga0495616_0005597 3300046513 Bacteria 7690
87 Ga0495643_0000586 3300046522 Bacteria 44354
88 Ga0495668_0000068 3300046616 Bacteria 176297
89 Ga0495634_0018355 3300046642 Unclassified 4980
90 Ga0495625_0016836 3300046660 Bacteria 5740
91 Ga0495625_0263562 3300046660 Bacteria 1114
92 Ga0495636_0000240 3300047318 Bacteria 21663
93 Ga0495684_0066237 3300047471 Bacteria 2746
94 Ga0495686_0000335 3300047472 Bacteria 77634
95 Ga0496115_0014236 3300048918 Bacteria 6020
96 Ga0496116_0001306 3300048919 Bacteria 28445
97 Ga0496117_0000478 3300048920 Bacteria 66542
98 Ga0496122_0088045 3300048925 Bacteria 2130
99 Ga0496123_0012067 3300048926 Bacteria 7410
100 Ga0496125_0000761 3300048928 Bacteria 52765
101 Ga0496125_0043023 3300048928 Bacteria 3840
102 Ga0496126_0019348 3300048929 Bacteria 6706
103 Ga0501047_0050267 3300049581 Bacteria 4026
104 Ga0501269_006685 3300049766 Bacteria 1393
105 Ga0501035_0061331 3300049822 Bacteria 3347
106 Ga0500641_0000691 3300053096 Bacteria 12203
107 Ga0500641_0000988 3300053096 Bacteria 10100
108 Ga0500594_0009696 3300053118 Bacteria 2222
109 Ga0500627_0009995 3300053158 Bacteria 3443
110 2644684103 2643221725 Bacteria 5087956
111 2722726762 2721755487 Bacteria 6357185
112 2738734833 2738541279 Bacteria 6149495
113 2738767592 2738541285 Bacteria 6150075
114 2739216415 2738543007 Bacteria 6149845
115 2739999601 2739367857 Bacteria 5433684
116 2740004417 2739367858 Bacteria 5432813
117 2740033574 2739367866 Bacteria 4215900
118 2802652001 2802428842 Bacteria 4926114
119 2833640873 2833640130 Bacteria 4858325
120 2839992407 2839989709 Bacteria 3773432
121 2842907764 2842903701 Bacteria 6986368
122 2881250651 2881247448 Bacteria 3717788
123 2890737577 2890737413 Bacteria 4269751
124 2890805169 2890804823 Bacteria 3717572
125 2896319573 2896317667 Bacteria 4606601
126 2896345180 2896344016 Bacteria 3811746
127 2898713384 2898713307 Bacteria 4110805
128 2904782172 2904780799 Bacteria 5840761
129 2919179575 2919177583 Bacteria 5641607
130 2958514059 2958512119 Bacteria 4528530
131 2977268751 2977268062 Bacteria 5243061
132 3003236989 3003233435 Bacteria 4458031
133 Ga0265318_10008455
134 JGI24739J22299_10000475
135 rootL2_10080210
136 rootL2_10080211
137 JGI25160J50197_1003022
138 Ga0055526_1010110
139 Ga0055526_1014782
140 Ga0055528_1000463
141 Ga0055530_10000261
142 Ga0055543_1011252
143 Ga0065165_1000148
144 Ga0065714_10067310
145 Ga0065704_10072462
146 Ga0065704_10118732
147 Ga0070689_100048188
148 Ga0070685_10006994
149 Ga0105244_10000508
150 Ga0105241_10182463
151 Ga0105242_10048034
152 Ga0105239_10062430
153 Ga0157373_10000038
154 Ga0157371_10014250
155 Ga0157370_10000573
156 Ga0157370_10005833
157 Ga0157370_10017853
158 Ga0157370_10063258
159 Ga0157369_10000402
160 Ga0163162_10202248
161 Ga0157372_10000026
162 Ga0157372_10001702
163 Ga0157372_10005143
164 Ga0157375_10006520
165 Ga0157380_10000065
166 Ga0182006_1004174
167 Ga0163161_10000083
168 Ga0163161_10000694
169 Ga0163161_10028042
170 Ga0209673_1000543
171 Ga0209564_1004627
172 Ga0209564_1008871
173 Ga0209758_1004190
174 Ga0209758_1011437
175 Ga0209050_1000359
176 Ga0207426_1000752
177 Ga0209257_1004378
178 Ga0207655_1000045
179 Ga0207690_10010138
180 Ga0207709_10000007
181 Ga0207670_10034104
182 Ga0265334_10031529
183 Ga0307515_10222504
184 Ga0316177_1019498
185 Ga0316183_1115618
186 Ga0316181_1088948
187 Ga0265327_10002725
188 Ga0265327_10003577
189 Ga0307408_100000572
190 Ga0316576_10063053
191 Ga0307414_10000137
192 Ga0307414_10001209
193 Ga0307414_10046954
194 Ga0307510_10014167
195 Ga0395899_0000040
196 Ga0395899_0000055
197 Ga0395899_0047563
198 Ga0395900_0103859
199 Ga0395905_0000001
200 Ga0395905_0001738
201 Ga0395901_0003573
202 Ga0400483_217432
203 Ga0400489_31646
204 Ga0451577_0000249
205 Ga0451577_0012837
206 Ga0451577_0074010
207 Ga0451577_0094553
208 Ga0453684_0006896
209 Ga0453684_0011621
210 Ga0453684_0030203
211 Ga0453684_0082227
212 Ga0453684_0090390
213 Ga0453684_0109557
214 Ga0453684_0233949
215 Ga0451576_0000003
216 Ga0451576_0084463
217 Ga0451576_0092054
218 Ga0495616_0005597
219 Ga0495643_0000586
220 Ga0495668_0000068
221 Ga0495634_0018355
222 Ga0495625_0016836
223 Ga0495625_0263562
224 Ga0495636_0000240
225 Ga0495684_0066237
226 Ga0495686_0000335
227 Ga0496115_0014236
228 Ga0496116_0001306
229 Ga0496117_0000478
230 Ga0496122_0088045
231 Ga0496123_0012067
232 Ga0496125_0000761
233 Ga0496125_0043023
234 Ga0496126_0019348
235 Ga0501047_0050267
236 Ga0501269_006685
237 Ga0501035_0061331
238 Ga0500641_0000691
239 Ga0500641_0000988
240 Ga0500594_0009696
241 Ga0500627_0009995
242 2644684103
243 2722726762
244 2738734833
245 2738767592
246 2739216415
247 2739999601
248 2740004417
249 2740033574
250 2802652001
251 2833640873
252 2839992407
253 2842907764
254 2881250651
255 2890737577
256 2890805169
257 2896319573
258 2896345180
259 2898713384
260 2904782172
261 2919179575
262 2958514059
263 2977268751
264 3003236989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00953

Glycos_transf_4

Glycosyl transferase family 4

193

340

0.88

Map