F153371

General Info

Members Datasets Scaffolds Average Seq Length
132 100 116 323

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10050161|Ga0307412_100501613
Length 361
Sequence LALDDNIYAKVEKKICNNLLSVKNTPIFVKKILQLSSIKKIGVFTSGGDAPGMNACIRAVVRTGLYHGKQMVGIHQGYQGMIEKKFSDMDSKSVCHIIQQGGTILKTARCMEFRTPEGRALAYKNLKEEGIDALVAIGGDGTFTGAELLSREFDIPVMCIPGTIDNDLYGTDFTLGYDTATNTVIEAIDKIRDTAASHDRLFFVEVMGRDSGCIALRAGVAGGAEAILLPEKETGIDDLIEKLEAGAGKNKTSSIVIIAEGEKNGGAYNVAKHVKEKFNFYDIKVTILGHLQRGGSPSSFDRILASRMGYAAVNCLIAGETRKMVGLRGNKMTLTELTEAINNHSFNLEEDLMEMSHILAL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
4 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
5 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
6 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
7 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
8 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
9 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
10 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
11 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
12 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
13 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
14 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
15 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
49 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
50 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
51 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
74 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
75 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
76 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
77 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
78 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
79 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
80 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
81 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
82 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
83 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
84 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
87 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
88 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
89 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
90 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
93 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
94 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
95 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
96 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
97 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
98 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
99 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere
100 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.12
Metatranscriptomes 0.76
Isolates 12.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.36
Nodule 0
Rhizoplane 1.52
Rhizosphere 65.91
Stem 0
Stem Tuber 0
Unclassified 21.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3180484 2162886007 Bacteria 35677
2 rootH1_10140180 3300003316 Bacteria 2077
3 rootH2_10028951 3300003320 Bacteria 22485
4 rootL2_10046204 3300003322 Bacteria 4849
5 rootL2_10096532 3300003322 Bacteria 4191
6 rootL2_10186180 3300003322 Bacteria 1863
7 rootH1_10011853 3300003323 Bacteria 14444
8 rootH1_10018519 3300003323 Bacteria 3639
9 rootH1_10200723 3300003323 Bacteria 1380
10 Ga0055536_1005339 3300003781 Bacteria 6308
11 Ga0055531_10000537 3300003794 Bacteria 33595
12 Ga0065165_1002172 3300005262 Bacteria 17718
13 Ga0065704_10070215 3300005289 Bacteria 70572
14 Ga0065704_10103422 3300005289 Bacteria 2172
15 Ga0068856_100369034 3300005614 Bacteria 1454
16 Ga0068861_100060083 3300005719 Bacteria 2912
17 Ga0068851_10000121 3300005834 Bacteria 42046
18 Ga0075431_100031049 3300006847 Bacteria 5503
19 Ga0075431_100301069 3300006847 Bacteria 1620
20 Ga0111539_10006729 3300009094 Bacteria 14789
21 Ga0111539_10008201 3300009094 Bacteria 13292
22 Ga0111539_10358514 3300009094 Bacteria 1697
23 Ga0105243_10000008 3300009148 Bacteria 390270
24 Ga0105249_10076330 3300009553 Bacteria 3106
25 Ga0157373_10001773 3300013100 Bacteria 16431
26 Ga0157371_10154776 3300013102 Bacteria 1636
27 Ga0157370_10022574 3300013104 Bacteria 6262
28 Ga0157372_10023278 3300013307 Bacteria 6714
29 Ga0157380_10000021 3300014326 Bacteria 114368
30 Ga0157380_10003428 3300014326 Bacteria 10888
31 Ga0157380_10365443 3300014326 Bacteria 1356
32 Ga0182008_10000006 3300014497 Bacteria 378521
33 Ga0182008_10013807 3300014497 Bacteria 4242
34 Ga0182007_10011113 3300015262 Bacteria 3516
35 Ga0163161_10000085 3300017792 Bacteria 93534
36 Ga0206351_10307949 3300020077 Bacteria 1122
37 Ga0209676_1000008 3300025292 Bacteria 991778
38 Ga0209676_1000558 3300025292 Bacteria 56412
39 Ga0209050_1000055 3300025298 Bacteria 339254
40 Ga0209050_1007334 3300025298 Bacteria 6210
41 Ga0209050_1015961 3300025298 Bacteria 3108
42 Ga0209257_1000006 3300025304 Bacteria 1570111
43 Ga0207656_10000067 3300025321 Bacteria 39362
44 Ga0207646_10330399 3300025922 Bacteria 1377
45 Ga0207709_10000006 3300025935 Bacteria 800946
46 Ga0207428_10078707 3300027907 Bacteria 2579
47 Ga0307515_10000724 3300028794 Bacteria 75975
48 Ga0307515_10095594 3300028794 Bacteria 3655
49 Ga0307515_10128639 3300028794 Bacteria 2807
50 Ga0316177_1020013 3300030731 Bacteria 7129
51 Ga0316176_1106169 3300030732 Bacteria 6446
52 Ga0316183_1033841 3300030742 Bacteria 14926
53 Ga0316181_1119930 3300030744 Bacteria 21111
54 Ga0265327_10011942 3300031251 Bacteria 5920
55 Ga0307513_10268657 3300031456 Bacteria 1490
56 Ga0307509_10022211 3300031507 Bacteria 7160
57 Ga0307408_100001111 3300031548 Bacteria 20516
58 Ga0307408_100007758 3300031548 Bacteria 7095
59 Ga0307405_10041479 3300031731 Bacteria 2795
60 Ga0307405_10326010 3300031731 Bacteria 1175
61 Ga0307413_10106012 3300031824 Bacteria 1869
62 Ga0307410_10127677 3300031852 Bacteria 1864
63 Ga0307407_10066974 3300031903 Bacteria 2120
64 Ga0307412_10001083 3300031911 Bacteria 15569
65 Ga0307412_10050161 3300031911 Unclassified 2753
66 Ga0307416_100003051 3300032002 Bacteria 9793
67 Ga0307414_10007812 3300032004 Bacteria 6033
68 Ga0307414_10017483 3300032004 Unclassified 4389
69 Ga0307414_10095882 3300032004 Bacteria 2218
70 Ga0307414_10303809 3300032004 Bacteria 1351
71 Ga0307411_10051078 3300032005 Bacteria 2696
72 Ga0307415_100016808 3300032126 Bacteria 4373
73 Ga0316574_0021207 3300035398 Bacteria 3855
74 Ga0395900_0016805 3300037418 Bacteria 7464
75 Ga0395900_0437355 3300037418 Bacteria 1266
76 Ga0395905_0000311 3300037471 Bacteria 70771
77 Ga0395905_0001369 3300037471 Bacteria 29631
78 Ga0395901_0111419 3300038443 Archaea 2874
79 Ga0451577_0212405 3300042876 Bacteria 1748
80 Ga0451577_0429197 3300042876 Bacteria 1200
81 Ga0453684_0006563 3300044712 Bacteria 22017
82 Ga0451576_0055882 3300045051 Bacteria 4129
83 Ga0451576_0063718 3300045051 Bacteria 3841
84 Ga0451576_0242564 3300045051 Bacteria 1882
85 Ga0495638_0000020 3300046460 Bacteria 372434
86 Ga0495597_0073972 3300046542 Unclassified 1464
87 Ga0495656_0009901 3300046615 Bacteria 3445
88 Ga0495636_0000049 3300047318 Bacteria 51760
89 Ga0496110_0001317 3300048913 Bacteria 17819
90 Ga0496110_0189267 3300048913 Bacteria 1869
91 Ga0496116_0000501 3300048919 Bacteria 53592
92 Ga0496117_0001265 3300048920 Bacteria 37550
93 Ga0496118_0089646 3300048921 Bacteria 2122
94 Ga0496121_0185902 3300048924 Bacteria 1495
95 Ga0496122_0003905 3300048925 Bacteria 19088
96 Ga0496123_0025566 3300048926 Bacteria 4447
97 Ga0496124_0000001 3300048927 Bacteria 1747840
98 Ga0496125_0203307 3300048928 Bacteria 1294
99 Ga0496126_0009195 3300048929 Bacteria 10540
100 Ga0496126_0069060 3300048929 Bacteria 3153
101 Ga0496126_0201800 3300048929 Bacteria 1679
102 Ga0501300_001391 3300049523 Bacteria 3630
103 Ga0501069_0234264 3300049585 Bacteria 1069
104 Ga0501217_032739 3300049661 Bacteria 1288
105 Ga0501240_002045 3300049673 Bacteria 2078
106 Ga0501242_003904 3300049674 Unclassified 1635
107 nmdc:mga06r32_68673_c1 3300050510 Bacteria 3424
108 nmdc:mga08y16_100788_c1 3300050511 Bacteria 3007
109 nmdc:mga08y16_77801_c1 3300050511 Bacteria 3459
110 nmdc:mga0rr50_417283_c1 3300050513 Bacteria 1135
111 Ga0500578_0118311 3300053086 Bacteria 1667
112 Ga0500618_029130 3300053125 Bacteria 1304
113 Ga0500604_0003977 3300053151 Bacteria 3949
114 Ga0500616_0000004 3300053153 Bacteria 1002714
115 Ga0500622_0000007 3300053156 Bacteria 425621
116 Ga0500622_0000013 3300053156 Bacteria 371650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0185902 Ga0496121_0185902_35_874 279
2 3300003322 rootL2_10046204 rootL2_100462042 289
3 3300006847 Ga0075431_100301069 Ga0075431_1003010692 289
4 3300009094 Ga0111539_10008201 Ga0111539_100082017 289
5 3300048928 Ga0496125_0203307 Ga0496125_0203307_143_1123 289
6 3300050511 nmdc:mga08y16_100788_c1 nmdc:mga08y16_100788_c1_1382_2365 289
7 3300025298 Ga0209050_1007334 Ga0209050_10073342 298
8 3300053153 Ga0500616_0000004 Ga0500616_0000004_996705_997688 298
9 3300005289 Ga0065704_10103422 Ga0065704_101034222 299
10 3300009148 Ga0105243_10000008 Ga0105243_100000085 299
11 3300025935 Ga0207709_10000006 Ga0207709_10000006474 299
12 3300048919 Ga0496116_0000501 Ga0496116_0000501_14216_15196 299
13 3300048920 Ga0496117_0001265 Ga0496117_0001265_4039_5019 299
14 3300048921 Ga0496118_0089646 Ga0496118_0089646_540_1520 299
15 3300048925 Ga0496122_0003905 Ga0496122_0003905_15517_16497 299
16 3300048926 Ga0496123_0025566 Ga0496123_0025566_3379_4359 299
17 3300046460 Ga0495638_0000020 Ga0495638_0000020_113733_114716 300
18 iso_pu_bacteria 2895498888 2895503137 302
19 3300006847 Ga0075431_100031049 Ga0075431_1000310493 305
20 3300042876 Ga0451577_0429197 Ga0451577_0429197_159_1085 307
21 3300028794 Ga0307515_10000724 Ga0307515_1000072430 312
22 3300031456 Ga0307513_10268657 Ga0307513_102686572 316
23 3300032004 Ga0307414_10095882 Ga0307414_100958822 318
24 3300032005 Ga0307411_10051078 Ga0307411_100510782 318
25 iso_pu_bacteria 2739367866 2740032564 318
26 iso_pu_bacteria 2839989709 2839992241 318
27 iso_pu_bacteria 2910245624 2910249157 318
28 3300005719 Ga0068861_100060083 Ga0068861_1000600832 320
29 iso_pu_bacteria 2721755487 2722728844 320
30 iso_pu_bacteria 2898713307 2898715483 320
31 iso_pu_bacteria 2904780799 2904785422 320
32 iso_pu_bacteria 2919177583 2919179204 320
33 iso_pu_bacteria 2896317667 2896317994 321
34 iso_pu_bacteria 2896344016 2896346436 321
35 iso_pu_bacteria 8055588893 8055589288 321
36 3300003316 rootH1_10140180 rootH1_101401802 322
37 3300003781 Ga0055536_1005339 Ga0055536_10053392 322
38 3300013102 Ga0157371_10154776 Ga0157371_101547762 322
39 3300013104 Ga0157370_10022574 Ga0157370_100225746 322
40 3300025292 Ga0209676_1000558 Ga0209676_100055829 322
41 3300025298 Ga0209050_1015961 Ga0209050_10159613 322
42 3300031251 Ga0265327_10011942 Ga0265327_100119424 322
43 3300031731 Ga0307405_10326010 Ga0307405_103260101 322
44 3300032004 Ga0307414_10303809 Ga0307414_103038091 322
45 3300037418 Ga0395900_0437355 Ga0395900_0437355_24_1013 322
46 3300038443 Ga0395901_0111419 Ga0395901_0111419_138_1106 322
47 3300048913 Ga0496110_0189267 Ga0496110_0189267_41_1009 322
48 iso_pu_bacteria 2842903701 2842903919 322
49 iso_pu_bacteria 2945997725 2946002224 322
50 3300045051 Ga0451576_0063718 Ga0451576_0063718_959_1933 323
51 3300050513 nmdc:mga0rr50_417283_c1 nmdc:mga0rr50_417283_c1_144_1118 323
52 3300013307 Ga0157372_10023278 Ga0157372_100232783 324
53 3300020077 Ga0206351_10307949 Ga0206351_103079491 324
54 3300025922 Ga0207646_10330399 Ga0207646_103303992 324
55 3300031548 Ga0307408_100001111 Ga0307408_10000111112 324
56 3300031548 Ga0307408_100007758 Ga0307408_1000077583 324
57 3300031911 Ga0307412_10001083 Ga0307412_100010838 324
58 3300050510 nmdc:mga06r32_68673_c1 nmdc:mga06r32_68673_c1_1383_2360 324
59 3300032004 Ga0307414_10007812 Ga0307414_100078124 325
60 3300042876 Ga0451577_0212405 Ga0451577_0212405_499_1479 325
61 3300044712 Ga0453684_0006563 Ga0453684_0006563_14981_15961 325
62 3300045051 Ga0451576_0242564 Ga0451576_0242564_802_1788 325
63 3300047318 Ga0495636_0000049 Ga0495636_0000049_28145_29125 325
64 3300049673 Ga0501240_002045 Ga0501240_002045_305_1288 325
65 iso_pu_bacteria 3003233435 3003235972 325
66 iso_pu_bacteria 8015556637 8015559559 325
67 3300003320 rootH2_10028951 rootH2_100289512 326
68 3300003322 rootL2_10096532 rootL2_100965324 326
69 3300003322 rootL2_10186180 rootL2_101861802 326
70 3300003323 rootH1_10011853 rootH1_100118532 326
71 3300003323 rootH1_10018519 rootH1_100185192 326
72 3300003323 rootH1_10200723 rootH1_102007232 326
73 3300003794 Ga0055531_10000537 Ga0055531_100005379 326
74 3300005262 Ga0065165_1002172 Ga0065165_100217210 326
75 3300005614 Ga0068856_100369034 Ga0068856_1003690342 326
76 3300009094 Ga0111539_10006729 Ga0111539_100067296 326
77 3300013100 Ga0157373_10001773 Ga0157373_100017737 326
78 3300014326 Ga0157380_10003428 Ga0157380_100034288 326
79 3300014326 Ga0157380_10365443 Ga0157380_103654432 326
80 3300014497 Ga0182008_10000006 Ga0182008_10000006239 326
81 3300014497 Ga0182008_10013807 Ga0182008_100138073 326
82 3300015262 Ga0182007_10011113 Ga0182007_100111133 326
83 3300017792 Ga0163161_10000085 Ga0163161_1000008525 326
84 3300025292 Ga0209676_1000008 Ga0209676_1000008312 326
85 3300025298 Ga0209050_1000055 Ga0209050_1000055100 326
86 3300025304 Ga0209257_1000006 Ga0209257_1000006306 326
87 3300027907 Ga0207428_10078707 Ga0207428_100787073 326
88 3300028794 Ga0307515_10095594 Ga0307515_100955944 326
89 3300028794 Ga0307515_10128639 Ga0307515_101286392 326
90 3300030731 Ga0316177_1020013 Ga0316177_10200133 326
91 3300030732 Ga0316176_1106169 Ga0316176_11061695 326
92 3300030742 Ga0316183_1033841 Ga0316183_103384112 326
93 3300030744 Ga0316181_1119930 Ga0316181_11199308 326
94 3300031507 Ga0307509_10022211 Ga0307509_100222116 326
95 3300031731 Ga0307405_10041479 Ga0307405_100414792 326
96 3300031824 Ga0307413_10106012 Ga0307413_101060122 326
97 3300031852 Ga0307410_10127677 Ga0307410_101276772 326
98 3300031903 Ga0307407_10066974 Ga0307407_100669742 326
99 3300032002 Ga0307416_100003051 Ga0307416_1000030516 326
100 3300032004 Ga0307414_10017483 Ga0307414_100174834 326
101 3300032126 Ga0307415_100016808 Ga0307415_1000168082 326
102 3300045051 Ga0451576_0055882 Ga0451576_0055882_1834_2817 326
103 3300046542 Ga0495597_0073972 Ga0495597_0073972_343_1326 326
104 3300049523 Ga0501300_001391 Ga0501300_001391_446_1429 326
105 3300049585 Ga0501069_0234264 Ga0501069_0234264_19_1002 326
106 3300049661 Ga0501217_032739 Ga0501217_032739_69_1052 326
107 3300049674 Ga0501242_003904 Ga0501242_003904_121_1104 326
108 3300050511 nmdc:mga08y16_77801_c1 nmdc:mga08y16_77801_c1_1216_2199 326
109 3300053086 Ga0500578_0118311 Ga0500578_0118311_278_1261 326
110 3300053151 Ga0500604_0003977 Ga0500604_0003977_1930_2913 326
111 3300053156 Ga0500622_0000007 Ga0500622_0000007_97536_98519 326
112 3300053156 Ga0500622_0000013 Ga0500622_0000013_275924_276907 326
113 iso_pu_bacteria 2890737413 2890739432 326
114 2162886007 SwRhRL2b_contig_3180484 SwRhRL2b_0812.00004610 329
115 3300005289 Ga0065704_10070215 Ga0065704_1007021510 329
116 3300005834 Ga0068851_10000121 Ga0068851_1000012129 329
117 3300009094 Ga0111539_10358514 Ga0111539_103585142 329
118 3300009553 Ga0105249_10076330 Ga0105249_100763301 329
119 3300014326 Ga0157380_10000021 Ga0157380_1000002114 329
120 3300025321 Ga0207656_10000067 Ga0207656_1000006729 329
121 3300031911 Ga0307412_10050161 Ga0307412_100501613 329
122 3300035398 Ga0316574_0021207 Ga0316574_0021207_1264_2271 329
123 3300037418 Ga0395900_0016805 Ga0395900_0016805_2492_3550 329
124 3300037471 Ga0395905_0000311 Ga0395905_0000311_3127_4185 329
125 3300037471 Ga0395905_0001369 Ga0395905_0001369_1548_2540 329
126 3300046615 Ga0495656_0009901 Ga0495656_0009901_923_1912 329
127 3300048913 Ga0496110_0001317 Ga0496110_0001317_7570_8559 329
128 3300048927 Ga0496124_0000001 Ga0496124_0000001_1403930_1404955 329
129 3300048929 Ga0496126_0009195 Ga0496126_0009195_130_1119 329
130 3300048929 Ga0496126_0069060 Ga0496126_0069060_2095_3084 329
131 3300048929 Ga0496126_0201800 Ga0496126_0201800_614_1603 329
132 3300053125 Ga0500618_029130 Ga0500618_029130_95_1192 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00365

PFK

Phosphofructokinase

40

316

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i4i-assembly1.cif.gz_D crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep 0.975 8 329
4i7e-assembly1.cif.gz_D crystal structure of the bacillus stearothermophilus phosphofructokinase mutant d12a in complex with pep 0.9742 8 329
3pfk-assembly1.cif.gz_A phosphofructokinase. structure and control 0.9739 8 329
1mto-assembly2.cif.gz_E crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate 0.9731 8 329
3u39-assembly1.cif.gz_A crystal structure of the apo bacillus stearothermophilus phosphofructokinase 0.9727 8 329
ID Description Score Start End Superfamily
af_Q2FXM8_1_303_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9798 8 309 3.40.50.450
3u39A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9714 8 312 3.40.50.450
af_Q2FXM8_1_303_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9703 8 309 3.40.50.450
3u39A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9663 8 312 3.40.50.450
af_E7F9M6_15_179_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.939 9 147 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A356L5L4-F1-model_v4 6-phosphofructokinase (EC 2.7.1.11) 0.994 7 152 GO:0003872
GO:0005524
GO:0005945
GO:0006002
GO:0016208
GO:0030388
GO:0042802
GO:0046872
GO:0048029
GO:0061621
GO:0070095
AF-A0A356E9H7-F1-model_v4 6-phosphofructokinase (EC 2.7.1.11) 0.9928 7 88 GO:0003872
GO:0005524
GO:0005945
GO:0006002
GO:0016208
GO:0030388
GO:0042802
GO:0046872
GO:0047334
GO:0048029
GO:0061621
GO:0070095
AF-A0A356IAN2-F1-model_v4 6-phosphofructokinase (EC 2.7.1.11) 0.9925 8 108 GO:0003872
GO:0005524
GO:0005945
GO:0006002
GO:0016208
GO:0030388
GO:0042802
GO:0046872
GO:0048029
GO:0061621
GO:0070095
AF-A0A658JA79-F1-model_v4 deleted 0.9925 8 104
AF-A0A3D1F7V5-F1-model_v4 6-phosphofructokinase (EC 2.7.1.11) 0.9921 6 146 GO:0003872
GO:0005524
GO:0005945
GO:0006002
GO:0016208
GO:0030388
GO:0042802
GO:0046872
GO:0048029
GO:0061621
GO:0070095

Feature Viewer

pLDDT pTM Quality
91.72 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map