F153443

General Info

Members Datasets Scaffolds Average Seq Length
132 109 264 150

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0119219|Ga0373943_0119219_718_1206
Length 162
Sequence MRALIQRVSEASVEVAGQVVSRIGQGFLVFVAAEKGDGAPEAEETARKIAGLRIFSDEQGRMNRSLADVAGAVLAVSQFTLVADLSRGRRPGFEKALAGSEAQPLYEHFCAALELAGVPVARGVFGADMRVSLVNDGPATFVMDVGGREVTERSPTLRAEPS

Samples

Sample ID Description Type Environment
1 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
79 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
80 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
81 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
82 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
83 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
87 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
92 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
93 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
94 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
95 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
100 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
101 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
102 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
105 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 2643221561 Nocardioides sp. Root151 Isolate Unclassified
108 2643221696 Nocardioides sp. Root140 Isolate Unclassified
109 2739367898 Nocardioides sp. CF479 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.88
Nodule 0
Rhizoplane 0.76
Rhizosphere 76.52
Stem 0
Stem Tuber 0
Unclassified 7.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373943_0119219 3300035170 Bacteria 1401
2 SwRhRL2b_contig_2255685 2162886007 Bacteria 19658
3 JGI24033J26618_1006323 3300002155 Bacteria 1327
4 JGI25157J39369_1015070 3300002741 Unclassified 954
5 JGI25150J39212_1000013 3300002774 Bacteria 182307
6 JGI25151J46595_10000004 3300003187 Bacteria 494006
7 JGI25153J46596_10000004 3300003215 Bacteria 494006
8 rootH2_10018141 3300003320 Bacteria 8135
9 rootH2_10249572 3300003320 Bacteria 1827
10 rootH1_10001478 3300003323 Bacteria 3320
11 rootH1_10115215 3300003323 Bacteria 4160
12 rootH1_10136665 3300003323 Bacteria 4865
13 Ga0065714_10095945 3300005288 Bacteria 1773
14 Ga0065714_10323528 3300005288 Bacteria 666
15 Ga0065704_10000425 3300005289 Bacteria 76756
16 Ga0070658_10002554 3300005327 Bacteria 15180
17 Ga0070670_100007147 3300005331 Bacteria 9455
18 Ga0070680_101112849 3300005336 Bacteria 683
19 Ga0070660_100190303 3300005339 Bacteria 1662
20 Ga0070661_100037854 3300005344 Bacteria 3510
21 Ga0070661_100154870 3300005344 Bacteria 1734
22 Ga0070674_101123423 3300005356 Bacteria 695
23 Ga0070698_100020377 3300005471 Bacteria 6950
24 Ga0070697_101880057 3300005536 Bacteria 536
25 Ga0070686_100050571 3300005544 Bacteria 2642
26 Ga0070664_100032228 3300005564 Bacteria 4383
27 Ga0070664_100064677 3300005564 Bacteria 3120
28 Ga0068857_100532576 3300005577 Bacteria 1105
29 Ga0068854_101047107 3300005578 Bacteria 725
30 Ga0068859_100126700 3300005617 Bacteria 2623
31 Ga0068859_100419135 3300005617 Bacteria 1435
32 Ga0068870_10048316 3300005840 Bacteria 2240
33 Ga0075365_10161349 3300006038 Bacteria 1562
34 Ga0075363_100504609 3300006048 Bacteria 719
35 Ga0075364_10022136 3300006051 Bacteria 4011
36 Ga0070716_101213337 3300006173 Bacteria 606
37 Ga0075370_10293962 3300006353 Bacteria 965
38 Ga0068871_101888253 3300006358 Bacteria 568
39 Ga0075428_100002191 3300006844 Bacteria 21126
40 Ga0097620_100126702 3300006931 Bacteria 2623
41 Ga0097620_100419119 3300006931 Bacteria 1435
42 Ga0105240_11853824 3300009093 Unclassified 628
43 Ga0111539_10016838 3300009094 Bacteria 9054
44 Ga0111539_11102612 3300009094 Unclassified 922
45 Ga0105239_10936421 3300010375 Bacteria 995
46 Ga0157373_10003105 3300013100 Bacteria 12551
47 Ga0157373_10032675 3300013100 Bacteria 3745
48 Ga0157371_10005385 3300013102 Bacteria 10807
49 Ga0157370_10000591 3300013104 Bacteria 45316
50 Ga0157370_10053400 3300013104 Bacteria 3853
51 Ga0157370_10114672 3300013104 Bacteria 2517
52 Ga0157375_11403079 3300013308 Bacteria 823
53 Ga0182008_10225063 3300014497 Bacteria 961
54 Ga0182006_1002331 3300015261 Bacteria 10444
55 Ga0163161_10444745 3300017792 Unclassified 1047
56 Ga0207425_1000008 3300025245 Bacteria 618024
57 Ga0209026_1003283 3300025250 Bacteria 5411
58 Ga0209129_1000042 3300025258 Bacteria 305537
59 Ga0209025_1000020 3300025294 Bacteria 618024
60 Ga0209758_1000022 3300025297 Bacteria 618024
61 Ga0207647_10006877 3300025904 Bacteria 8246
62 Ga0207705_10002162 3300025909 Bacteria 15224
63 Ga0207684_10283789 3300025910 Unclassified 1428
64 Ga0207707_10072897 3300025912 Bacteria 2994
65 Ga0207660_10282924 3300025917 Bacteria 1317
66 Ga0207657_10032081 3300025919 Bacteria 4750
67 Ga0207649_10013100 3300025920 Bacteria 4624
68 Ga0207649_10258474 3300025920 Bacteria 1257
69 Ga0207650_10053776 3300025925 Bacteria 2985
70 Ga0207670_11187115 3300025936 Bacteria 646
71 Ga0207669_10387997 3300025937 Bacteria 1090
72 Ga0207679_10018132 3300025945 Bacteria 4709
73 Ga0207679_10084175 3300025945 Bacteria 2440
74 Ga0207668_10432674 3300025972 Bacteria 1119
75 Ga0207640_11533016 3300025981 Bacteria 599
76 Ga0207674_10020510 3300026116 Bacteria 7139
77 Ga0207428_10103099 3300027907 Bacteria 2202
78 Ga0316576_10074531 3300031727 Bacteria 2510
79 Ga0307405_10054918 3300031731 Bacteria 2490
80 Ga0307406_10279857 3300031901 Bacteria 1272
81 Ga0307407_10095609 3300031903 Bacteria 1832
82 Ga0307412_10000001 3300031911 Bacteria 822691
83 Ga0307412_10000093 3300031911 Bacteria 75863
84 Ga0307412_10065577 3300031911 Unclassified 2458
85 Ga0307409_100111300 3300031995 Bacteria 2296
86 Ga0307416_100000368 3300032002 Bacteria 23473
87 Ga0307414_10007079 3300032004 Bacteria 6291
88 Ga0307414_10021383 3300032004 Bacteria 4058
89 Ga0307414_10837935 3300032004 Bacteria 840
90 Ga0307411_10649451 3300032005 Unclassified 913
91 Ga0307415_100002639 3300032126 Bacteria 8939
92 Ga0307415_101111950 3300032126 Bacteria 740
93 Ga0395899_0000021 3300037312 Bacteria 391702
94 Ga0395900_0047944 3300037418 Bacteria 4401
95 Ga0436364_0580151 3300037853 Bacteria 9229
96 Ga0436365_0329583 3300039437 Bacteria 52503
97 Ga0450907_007939 3300042146 Bacteria 1767
98 Ga0450893_0001342 3300042532 Bacteria 3740
99 Ga0495621_0165332 3300046539 Bacteria 877
100 Ga0495668_0000106 3300046616 Bacteria 133476
101 Ga0495668_0199636 3300046616 Unclassified 1095
102 Ga0495588_0377885 3300046674 Bacteria 744
103 Ga0495647_0132596 3300046681 Bacteria 1057
104 Ga0495658_0031893 3300046683 Bacteria 2873
105 Ga0495581_0107123 3300047315 Bacteria 1625
106 Ga0496114_0026433 3300048917 Bacteria 4752
107 Ga0496121_0036793 3300048924 Bacteria 4357
108 Ga0501032_0010521 3300049569 Bacteria 6674
109 Ga0501033_0628146 3300049570 Bacteria 735
110 Ga0501042_0795596 3300049578 Unclassified 688
111 Ga0501069_0044973 3300049585 Bacteria 2445
112 Ga0501072_0023140 3300049588 Bacteria 4825
113 Ga0501073_0074310 3300049589 Bacteria 2367
114 Ga0501217_045290 3300049661 Bacteria 1133
115 Ga0501252_007766 3300049682 Bacteria 1221
116 Ga0501079_0059684 3300049741 Bacteria 2942
117 Ga0501079_1629664 3300049741 Bacteria 507
118 Ga0501080_0083698 3300049742 Bacteria 2964
119 Ga0501081_1306435 3300049743 Unclassified 550
120 Ga0501241_005968 3300049758 Bacteria 2259
121 Ga0501241_007323 3300049758 Bacteria 2022
122 nmdc:mga03n38_198484_c1 3300050490 Bacteria 1037
123 nmdc:mga00v17_32287_c1 3300050491 Bacteria 3093
124 nmdc:mga0yw44_137398_c1 3300050492 Bacteria 1586
125 nmdc:mga08y16_38193_c1 3300050511 Bacteria 5043
126 Ga0500651_0000102 3300053093 Bacteria 52381
127 Ga0500568_0173919 3300053139 Bacteria 792
128 Ga0500568_0188432 3300053139 Bacteria 757
129 Ga0501082_0499742 3300060353 Bacteria 1063
130 2643826372 2643221561 Bacteria 4984412
131 2644532743 2643221696 Bacteria 5431823
132 2740165957 2739367898 Bacteria 4367674
133 Ga0373943_0119219
134 SwRhRL2b_contig_2255685
135 JGI24033J26618_1006323
136 JGI25157J39369_1015070
137 JGI25150J39212_1000013
138 JGI25151J46595_10000004
139 JGI25153J46596_10000004
140 rootH2_10018141
141 rootH2_10249572
142 rootH1_10001478
143 rootH1_10115215
144 rootH1_10136665
145 Ga0065714_10095945
146 Ga0065714_10323528
147 Ga0065704_10000425
148 Ga0070658_10002554
149 Ga0070670_100007147
150 Ga0070680_101112849
151 Ga0070660_100190303
152 Ga0070661_100037854
153 Ga0070661_100154870
154 Ga0070674_101123423
155 Ga0070698_100020377
156 Ga0070697_101880057
157 Ga0070686_100050571
158 Ga0070664_100032228
159 Ga0070664_100064677
160 Ga0068857_100532576
161 Ga0068854_101047107
162 Ga0068859_100126700
163 Ga0068859_100419135
164 Ga0068870_10048316
165 Ga0075365_10161349
166 Ga0075363_100504609
167 Ga0075364_10022136
168 Ga0070716_101213337
169 Ga0075370_10293962
170 Ga0068871_101888253
171 Ga0075428_100002191
172 Ga0097620_100126702
173 Ga0097620_100419119
174 Ga0105240_11853824
175 Ga0111539_10016838
176 Ga0111539_11102612
177 Ga0105239_10936421
178 Ga0157373_10003105
179 Ga0157373_10032675
180 Ga0157371_10005385
181 Ga0157370_10000591
182 Ga0157370_10053400
183 Ga0157370_10114672
184 Ga0157375_11403079
185 Ga0182008_10225063
186 Ga0182006_1002331
187 Ga0163161_10444745
188 Ga0207425_1000008
189 Ga0209026_1003283
190 Ga0209129_1000042
191 Ga0209025_1000020
192 Ga0209758_1000022
193 Ga0207647_10006877
194 Ga0207705_10002162
195 Ga0207684_10283789
196 Ga0207707_10072897
197 Ga0207660_10282924
198 Ga0207657_10032081
199 Ga0207649_10013100
200 Ga0207649_10258474
201 Ga0207650_10053776
202 Ga0207670_11187115
203 Ga0207669_10387997
204 Ga0207679_10018132
205 Ga0207679_10084175
206 Ga0207668_10432674
207 Ga0207640_11533016
208 Ga0207674_10020510
209 Ga0207428_10103099
210 Ga0316576_10074531
211 Ga0307405_10054918
212 Ga0307406_10279857
213 Ga0307407_10095609
214 Ga0307412_10000001
215 Ga0307412_10000093
216 Ga0307412_10065577
217 Ga0307409_100111300
218 Ga0307416_100000368
219 Ga0307414_10007079
220 Ga0307414_10021383
221 Ga0307414_10837935
222 Ga0307411_10649451
223 Ga0307415_100002639
224 Ga0307415_101111950
225 Ga0395899_0000021
226 Ga0395900_0047944
227 Ga0436364_0580151
228 Ga0436365_0329583
229 Ga0450907_007939
230 Ga0450893_0001342
231 Ga0495621_0165332
232 Ga0495668_0000106
233 Ga0495668_0199636
234 Ga0495588_0377885
235 Ga0495647_0132596
236 Ga0495658_0031893
237 Ga0495581_0107123
238 Ga0496114_0026433
239 Ga0496121_0036793
240 Ga0501032_0010521
241 Ga0501033_0628146
242 Ga0501042_0795596
243 Ga0501069_0044973
244 Ga0501072_0023140
245 Ga0501073_0074310
246 Ga0501217_045290
247 Ga0501252_007766
248 Ga0501079_0059684
249 Ga0501079_1629664
250 Ga0501080_0083698
251 Ga0501081_1306435
252 Ga0501241_005968
253 Ga0501241_007323
254 nmdc:mga03n38_198484_c1
255 nmdc:mga00v17_32287_c1
256 nmdc:mga0yw44_137398_c1
257 nmdc:mga08y16_38193_c1
258 Ga0500651_0000102
259 Ga0500568_0173919
260 Ga0500568_0188432
261 Ga0501082_0499742
262 2643826372
263 2644532743
264 2740165957

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

2

144

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9665 1 147
3kod-assembly2.cif.gz_C dtd from plasmodium falciparum in complex with d-serine 0.9653 1 148
3lmv-assembly3.cif.gz_F d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9634 1 148
3ko3-assembly2.cif.gz_C d-tyrosyl-trna(tyr) deacylase from plasmodium falciparum incomplex with adp, obtained through soaking native enzyme crystal with the atp 0.963 1 147
3lmv-assembly2.cif.gz_C d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9619 1 148
ID Description Score Start End Superfamily
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9804 1 147 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9783 1 147 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9665 1 147 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9655 1 145 3.50.80.10
af_F1QGC8_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9628 1 145 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A562MVL7-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9958 2 149 GO:0000049
GO:0005737
GO:0016020
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A6A5L4H2-F1-model_v4 deleted 0.9953 1 150
AF-A0A816XGZ0-F1-model_v4 D-aminoacyl-tRNA deacylase (EC 3.1.1.96) 0.9945 1 147 GO:0000049
GO:0004820
GO:0005524
GO:0005737
GO:0006426
GO:0016020
GO:0051499
AF-A0A5Q5G703-F1-model_v4 deleted 0.9943 2 150
AF-A0A841JMQ7-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9941 1 150 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026

Map