F159282

General Info

Members Datasets Scaffolds Average Seq Length
134 96 268 144

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100096350|Ga0068864_1000963502
Length 172
Sequence MSSFEYRSRVEACQKSFRPSTLSAWPLYAPGVSRKSAKIAELIEQCRGHALDAHYLGYFECFNRQLFYEAHDVLEELWLDDRKGPNDAFYKGLIQLAGAFVHLQKNRVRPSAALLKLARANLEKYPAAHQHLNVGQVLKVIDEWLELIESQEFAVNPLSNTNPPRLGLLTSA

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
38 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
40 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
41 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
42 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
43 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
44 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
47 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
48 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
55 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
56 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
57 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
58 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
59 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
61 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
62 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
63 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
87 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
88 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.75
Rhizosphere 97.01
Stem 0
Stem Tuber 0
Unclassified 23.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100096350 3300005618 Bacteria 2618
2 rootH2_10045819 3300003320 Bacteria 2473
3 rootH1_10192577 3300003323 Bacteria 1460
4 Ga0070658_10511157 3300005327 Unclassified 1038
5 Ga0070674_100637520 3300005356 Unclassified 904
6 Ga0070673_100737622 3300005364 Unclassified 906
7 Ga0070688_100021849 3300005365 Unclassified 3742
8 Ga0070714_100050349 3300005435 Bacteria 3548
9 Ga0070705_100227194 3300005440 Bacteria 1296
10 Ga0070681_10048561 3300005458 Bacteria 4240
11 Ga0068855_100172187 3300005563 Bacteria 2451
12 Ga0068855_101108786 3300005563 Bacteria 827
13 Ga0068852_102208928 3300005616 Unclassified 572
14 Ga0068859_100214583 3300005617 Bacteria 2011
15 Ga0068860_100089778 3300005843 Bacteria 2926
16 Ga0097620_100214592 3300006931 Bacteria 2011
17 Ga0097620_101633852 3300006931 Bacteria 712
18 Ga0105240_10168825 3300009093 Bacteria 2593
19 Ga0105242_10072622 3300009176 Bacteria 2858
20 Ga0105242_10617385 3300009176 Bacteria 1050
21 Ga0105248_10447611 3300009177 Bacteria 1455
22 Ga0105237_10236156 3300009545 Bacteria 1829
23 Ga0105238_10008723 3300009551 Bacteria 10143
24 Ga0105238_10106010 3300009551 Bacteria 2792
25 Ga0157370_10240423 3300013104 Bacteria 1675
26 Ga0157374_10587339 3300013296 Bacteria 1123
27 Ga0157372_10540264 3300013307 Bacteria 1359
28 Ga0163163_10237255 3300014325 Bacteria 1873
29 Ga0163163_10634128 3300014325 Bacteria 1132
30 Ga0163163_10908901 3300014325 Bacteria 944
31 Ga0157376_11547862 3300014969 Unclassified 697
32 Ga0207707_10598843 3300025912 Bacteria 933
33 Ga0207695_10173395 3300025913 Bacteria 2081
34 Ga0207652_10162597 3300025921 Bacteria 2001
35 Ga0207694_10174775 3300025924 Unclassified 1740
36 Ga0207694_10199027 3300025924 Bacteria 1629
37 Ga0207664_10255557 3300025929 Bacteria 1531
38 Ga0207686_10177420 3300025934 Bacteria 1508
39 Ga0207670_10016517 3300025936 Unclassified 4438
40 Ga0207667_10505755 3300025949 Unclassified 1225
41 Ga0207667_10669006 3300025949 Bacteria 1042
42 Ga0207703_11072205 3300026035 Bacteria 774
43 Ga0207708_10399612 3300026075 Bacteria 1136
44 Ga0207698_11008352 3300026142 Bacteria 843
45 Ga0265355_1004044 3300028036 Bacteria 1096
46 Ga0268265_10188537 3300028380 Bacteria 1779
47 Ga0265337_1000305 3300028556 Bacteria 26124
48 Ga0265337_1000454 3300028556 Bacteria 21728
49 Ga0265337_1012415 3300028556 Bacteria 2895
50 Ga0265337_1035472 3300028556 Unclassified 1461
51 Ga0265326_10042947 3300028558 Bacteria 1283
52 Ga0265326_10118136 3300028558 Bacteria 754
53 Ga0265319_1014482 3300028563 Bacteria 3092
54 Ga0265319_1015915 3300028563 Viruses 2895
55 Ga0265334_10144293 3300028573 Unclassified 842
56 Ga0265323_10031283 3300028653 Unclassified 1979
57 Ga0265336_10015541 3300028666 Bacteria 2500
58 Ga0265338_10001504 3300028800 Bacteria 37705
59 Ga0265338_10003857 3300028800 Bacteria 20792
60 Ga0265338_10006741 3300028800 Bacteria 14504
61 Ga0265338_10015092 3300028800 Bacteria 8524
62 Ga0265338_10018060 3300028800 Bacteria 7568
63 Ga0265338_10107675 3300028800 Bacteria 2253
64 Ga0265338_10149041 3300028800 Bacteria 1820
65 Ga0265338_10366831 3300028800 Bacteria 1032
66 Ga0265338_10447570 3300028800 Bacteria 915
67 Ga0265338_10903116 3300028800 Bacteria 601
68 Ga0265324_10002022 3300029957 Bacteria 10795
69 Ga0307511_10264028 3300030521 Bacteria 813
70 Ga0265330_10082026 3300031235 Unclassified 1389
71 Ga0265320_10009243 3300031240 Bacteria 5960
72 Ga0265320_10105077 3300031240 Bacteria 1298
73 Ga0265325_10114391 3300031241 Unclassified 1307
74 Ga0265325_10169074 3300031241 Bacteria 1024
75 Ga0265329_10002382 3300031242 Bacteria 8540
76 Ga0265329_10131817 3300031242 Unclassified 805
77 Ga0265340_10173831 3300031247 Bacteria 975
78 Ga0265316_10036246 3300031344 Bacteria 3988
79 Ga0265316_10093954 3300031344 Unclassified 2285
80 Ga0265316_10164256 3300031344 Bacteria 1659
81 Ga0265316_10209753 3300031344 Bacteria 1441
82 Ga0265316_10339628 3300031344 Bacteria 1089
83 Ga0265314_10000499 3300031711 Bacteria 50725
84 Ga0265314_10167101 3300031711 Unclassified 1332
85 Ga0265342_10241238 3300031712 Unclassified 967
86 Ga0373930_0009042 3300034816 Bacteria 1755
87 Ga0373926_0131564 3300035083 Unclassified 948
88 Ga0373928_0000644 3300035084 Bacteria 6849
89 Ga0373923_0137127 3300035111 Bacteria 1104
90 Ga0373932_0000002 3300035112 Bacteria 711821
91 Ga0373945_0023046 3300035116 Bacteria 2149
92 Ga0373953_0265588 3300035117 Unclassified 747
93 Ga0373962_0000110 3300035242 Bacteria 17917
94 Ga0373931_0000012 3300035691 Bacteria 267735
95 Ga0373927_0100656 3300035695 Bacteria 1879
96 Ga0373947_0199043 3300035725 Unclassified 1310
97 Ga0373925_0035777 3300037068 Bacteria 3665
98 Ga0373925_0633707 3300037068 Unclassified 881
99 Ga0451807_0515400 3300041486 Bacteria 1636
100 Ga0451577_0064799 3300042876 Unclassified 3258
101 Ga0453683_0814312 3300044673 Unclassified 615
102 Ga0453684_0349855 3300044712 Bacteria 1667
103 Ga0453684_0725687 3300044712 Unclassified 1078
104 Ga0451576_0909671 3300045051 Unclassified 923
105 Ga0495592_0078632 3300046454 Bacteria 2389
106 Ga0495603_0860673 3300046455 Unclassified 516
107 Ga0495641_0161310 3300046461 Unclassified 1003
108 Ga0495651_0301346 3300046462 Bacteria 1075
109 Ga0495580_0347795 3300046472 Bacteria 1005
110 Ga0495582_0136206 3300046473 Bacteria 1389
111 Ga0495630_0000040 3300046517 Bacteria 106232
112 Ga0495630_0051341 3300046517 Bacteria 3087
113 Ga0495666_0015050 3300046526 Bacteria 3850
114 Ga0495586_0000018 3300046535 Bacteria 112658
115 Ga0495645_0124422 3300046543 Bacteria 1813
116 Ga0495645_0517555 3300046543 Unclassified 744
117 Ga0495667_0152673 3300046559 Bacteria 1487
118 Ga0495634_0007105 3300046642 Bacteria 8443
119 Ga0495634_0432664 3300046642 Bacteria 778
120 Ga0495635_0470084 3300046663 Bacteria 830
121 Ga0495599_0070827 3300046678 Bacteria 2176
122 Ga0495623_0532949 3300046679 Unclassified 617
123 Ga0495669_0111673 3300046684 Unclassified 1276
124 Ga0495613_0124409 3300046689 Bacteria 1850
125 Ga0495613_0260358 3300046689 Bacteria 1209
126 Ga0495581_0035646 3300047315 Bacteria 2878
127 Ga0495674_0000489 3300047319 Bacteria 36129
128 Ga0495674_0077178 3300047319 Bacteria 2864
129 Ga0495676_0019082 3300047321 Bacteria 6036
130 Ga0495676_0720374 3300047321 Bacteria 645
131 Ga0495683_0163742 3300047323 Unclassified 1027
132 Ga0495675_0295222 3300047444 Bacteria 964
133 nmdc:mga05p37_1221497_c1 3300050507 Bacteria 774
134 nmdc:mga08y16_660184_c1 3300050511 Bacteria 1049
135 Ga0068864_100096350
136 rootH2_10045819
137 rootH1_10192577
138 Ga0070658_10511157
139 Ga0070674_100637520
140 Ga0070673_100737622
141 Ga0070688_100021849
142 Ga0070714_100050349
143 Ga0070705_100227194
144 Ga0070681_10048561
145 Ga0068855_100172187
146 Ga0068855_101108786
147 Ga0068852_102208928
148 Ga0068859_100214583
149 Ga0068860_100089778
150 Ga0097620_100214592
151 Ga0097620_101633852
152 Ga0105240_10168825
153 Ga0105242_10072622
154 Ga0105242_10617385
155 Ga0105248_10447611
156 Ga0105237_10236156
157 Ga0105238_10008723
158 Ga0105238_10106010
159 Ga0157370_10240423
160 Ga0157374_10587339
161 Ga0157372_10540264
162 Ga0163163_10237255
163 Ga0163163_10634128
164 Ga0163163_10908901
165 Ga0157376_11547862
166 Ga0207707_10598843
167 Ga0207695_10173395
168 Ga0207652_10162597
169 Ga0207694_10174775
170 Ga0207694_10199027
171 Ga0207664_10255557
172 Ga0207686_10177420
173 Ga0207670_10016517
174 Ga0207667_10505755
175 Ga0207667_10669006
176 Ga0207703_11072205
177 Ga0207708_10399612
178 Ga0207698_11008352
179 Ga0265355_1004044
180 Ga0268265_10188537
181 Ga0265337_1000305
182 Ga0265337_1000454
183 Ga0265337_1012415
184 Ga0265337_1035472
185 Ga0265326_10042947
186 Ga0265326_10118136
187 Ga0265319_1014482
188 Ga0265319_1015915
189 Ga0265334_10144293
190 Ga0265323_10031283
191 Ga0265336_10015541
192 Ga0265338_10001504
193 Ga0265338_10003857
194 Ga0265338_10006741
195 Ga0265338_10015092
196 Ga0265338_10018060
197 Ga0265338_10107675
198 Ga0265338_10149041
199 Ga0265338_10366831
200 Ga0265338_10447570
201 Ga0265338_10903116
202 Ga0265324_10002022
203 Ga0307511_10264028
204 Ga0265330_10082026
205 Ga0265320_10009243
206 Ga0265320_10105077
207 Ga0265325_10114391
208 Ga0265325_10169074
209 Ga0265329_10002382
210 Ga0265329_10131817
211 Ga0265340_10173831
212 Ga0265316_10036246
213 Ga0265316_10093954
214 Ga0265316_10164256
215 Ga0265316_10209753
216 Ga0265316_10339628
217 Ga0265314_10000499
218 Ga0265314_10167101
219 Ga0265342_10241238
220 Ga0373930_0009042
221 Ga0373926_0131564
222 Ga0373928_0000644
223 Ga0373923_0137127
224 Ga0373932_0000002
225 Ga0373945_0023046
226 Ga0373953_0265588
227 Ga0373962_0000110
228 Ga0373931_0000012
229 Ga0373927_0100656
230 Ga0373947_0199043
231 Ga0373925_0035777
232 Ga0373925_0633707
233 Ga0451807_0515400
234 Ga0451577_0064799
235 Ga0453683_0814312
236 Ga0453684_0349855
237 Ga0453684_0725687
238 Ga0451576_0909671
239 Ga0495592_0078632
240 Ga0495603_0860673
241 Ga0495641_0161310
242 Ga0495651_0301346
243 Ga0495580_0347795
244 Ga0495582_0136206
245 Ga0495630_0000040
246 Ga0495630_0051341
247 Ga0495666_0015050
248 Ga0495586_0000018
249 Ga0495645_0124422
250 Ga0495645_0517555
251 Ga0495667_0152673
252 Ga0495634_0007105
253 Ga0495634_0432664
254 Ga0495635_0470084
255 Ga0495599_0070827
256 Ga0495623_0532949
257 Ga0495669_0111673
258 Ga0495613_0124409
259 Ga0495613_0260358
260 Ga0495581_0035646
261 Ga0495674_0000489
262 Ga0495674_0077178
263 Ga0495676_0019082
264 Ga0495676_0720374
265 Ga0495683_0163742
266 Ga0495675_0295222
267 nmdc:mga05p37_1221497_c1
268 nmdc:mga08y16_660184_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03745

DUF309

Domain of unknown function (DUF309)

55

114

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ijq-assembly2.cif.gz_B crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 0.8688 24 138
4zey-assembly1.cif.gz_A crystal structure of a nuclear receptor binding factor 2 mit domain (nrbf2) from homo sapiens at 1.50 a resolution 0.7961 54 121
2ijq-assembly2.cif.gz_B crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 0.7857 24 138
2ijq-assembly1.cif.gz_A crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 0.7492 13 131
2crb-assembly1.cif.gz_A solution structure of mit domain from mouse nrbf-2 0.721 54 121
ID Description Score Start End Superfamily
2ijqB00 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.8688 24 138 1.10.3450.10
af_Q4D7C7_4_76_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8369 58 124 1.20.58.80
af_Q2FY75_1_133_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.8343 24 138 1.10.3450.10
af_Q9VHF6_403_478_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8186 58 124 1.20.58.80
af_O80675_54_197_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.8152 13 122 1.10.3450.10
ID Description Score Start End GO Terms
AF-A0A535DMX7-F1-model_v4 DUF309 domain-containing protein 0.9735 21 94
AF-A0A0C1UV85-F1-model_v4 deleted 0.9663 30 120
AF-A0A846ATQ7-F1-model_v4 DUF309 domain-containing protein 0.9553 24 121
AF-A0A2T6DEM2-F1-model_v4 DUF309 domain-containing protein 0.9548 1 140
AF-A0A2V5MQB5-F1-model_v4 DUF309 domain-containing protein 0.9534 1 141

Map