F159758

General Info

Members Datasets Scaffolds Average Seq Length
134 58 270 345

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10032119|Ga0105239_100321193
Length 410
Sequence LNFSHSSLVYRWFIIYLRNRLCKYIKLIHKRIFIVIYCVPERLFIAGINDKLDAFPQHTYNAGMSIEDRYKLNKEITLIDIANELNVSKSTVSRALQNHHSIGAETTKAVHELAKKYNYQPNAIASSLFKKSTKTIGVIVPILSHYFFSTVIAGIEDVAYKAGYKVIICQSHELYEREVIVSKTLLSAKVDGLIVSVSKETVNMDHFQQFLDKNIPLIFFDRLPTGIQSNSVSVDDYEGAFKIVEHLIEQGCKRIAHFTGPLNIALAQNRLQGYKDALRKHHIPVNDELIYECGFERTQGITTTEKLLTDQVSVDAIFAVCDPVAIGVMLTLKQKSIKIPHDIAVVGFNDDPTATVIDPPLTTVAQPAFEIGVAAADIFLKQVIGPSRSYIKEVLKTNLTIRQSSLRKNR

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
17 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
18 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
27 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
28 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
29 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
30 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
31 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
32 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
33 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
34 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
35 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
36 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
37 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
40 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
41 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
42 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
43 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
44 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
45 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
46 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
47 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
48 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
49 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
50 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
51 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
52 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
53 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
54 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
55 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
56 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
57 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
58 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.69
Nodule 0
Rhizoplane 0
Rhizosphere 72.39
Stem 0
Stem Tuber 0
Unclassified 12.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10032119 3300010375 Bacteria 5770
2 JGI25162J39368_1000137 3300002737 Bacteria 78951
3 rootH1_10002106 3300003316 Bacteria 7429
4 rootH1_10020816 3300003316 Bacteria 5017
5 rootH1_10020816 3300003323 Bacteria 13962
6 rootH1_10108128 3300003316 Unclassified 2622
7 rootH2_10006168 3300003320 Bacteria 47117
8 rootH2_10155247 3300003320 Bacteria 2546
9 rootL2_10000158 3300003322 Bacteria 50986
10 rootL2_10151806 3300003322 Bacteria 8803
11 rootL2_10182522 3300003322 Bacteria 3065
12 rootL2_10245536 3300003322 Bacteria 3422
13 rootL2_10253416 3300003322 Bacteria 5406
14 rootH1_10009752 3300003323 Bacteria 15443
15 rootH1_10028721 3300003316 Bacteria 3181
16 rootH1_10028721 3300003323 Bacteria 8710
17 rootH1_10031428 3300003323 Bacteria 10538
18 rootH1_10034368 3300003323 Bacteria 15752
19 rootH1_10053290 3300003323 Bacteria 3180
20 rootH1_10101639 3300003323 Unclassified 4327
21 rootH1_10130046 3300003323 Bacteria 6113
22 rootH1_10279879 3300003323 Bacteria 2549
23 Ga0055531_10000223 3300003794 Bacteria 62728
24 Ga0065165_1001877 3300005262 Bacteria 20331
25 Ga0070680_100083793 3300005336 Bacteria 2633
26 Ga0070665_100389852 3300005548 Bacteria 1400
27 Ga0068855_100238895 3300005563 Bacteria 2031
28 Ga0068856_100090035 3300005614 Bacteria 3052
29 Ga0105240_10243221 3300009093 Bacteria 2085
30 Ga0105240_10324548 3300009093 Bacteria 1753
31 Ga0111539_10002515 3300009094 Bacteria 24297
32 Ga0111539_10011557 3300009094 Bacteria 11081
33 Ga0105239_10034106 3300010375 Bacteria 5588
34 Ga0157372_10056567 3300013307 Bacteria 4383
35 Ga0209437_100143 3300025233 Bacteria 164970
36 Ga0209129_1010249 3300025258 Bacteria 2363
37 Ga0209050_1006797 3300025298 Bacteria 6659
38 Ga0209257_1000005 3300025304 Bacteria 1592528
39 Ga0207695_10254896 3300025913 Bacteria 1653
40 Ga0207671_10011166 3300025914 Bacteria 7335
41 Ga0207671_10024308 3300025914 Bacteria 4558
42 Ga0207660_10273998 3300025917 Bacteria 1337
43 Ga0207667_10031706 3300025949 Bacteria 5704
44 Ga0207702_10067391 3300026078 Bacteria 3072
45 Ga0268266_10333551 3300028379 Bacteria 1422
46 Ga0265334_10014998 3300028573 Bacteria 3225
47 Ga0265323_10000283 3300028653 Bacteria 29455
48 Ga0265323_10002273 3300028653 Bacteria 8910
49 Ga0265336_10011149 3300028666 Bacteria 3064
50 Ga0265338_10060036 3300028800 Bacteria 3346
51 Ga0265327_10046195 3300031251 Bacteria 2308
52 Ga0265327_10049172 3300031251 Bacteria 2213
53 Ga0265316_10003867 3300031344 Bacteria 15017
54 Ga0265316_10008318 3300031344 Bacteria 9631
55 Ga0307408_100003975 3300031548 Bacteria 10073
56 Ga0316576_10037919 3300031727 Bacteria 3453
57 Ga0316576_10113100 3300031727 Unclassified 2036
58 Ga0316576_10127878 3300031727 Bacteria 1910
59 Ga0307516_10221296 3300031730 Bacteria 1602
60 Ga0307405_10095948 3300031731 Unclassified 1976
61 Ga0307413_10040469 3300031824 Unclassified 2720
62 Ga0307412_10010343 3300031911 Bacteria 5372
63 Ga0307412_10322437 3300031911 Unclassified 1230
64 Ga0307416_100028150 3300032002 Unclassified 4175
65 Ga0307416_100276654 3300032002 Bacteria 1652
66 Ga0316574_0101550 3300035398 Bacteria 1841
67 Ga0316574_0117970 3300035398 Bacteria 1703
68 Ga0400483_259523 3300039062 Unclassified 2184
69 Ga0451577_0000010 3300042876 Bacteria 616686
70 Ga0451577_0000754 3300042876 Bacteria 49345
71 Ga0451577_0001692 3300042876 Bacteria 28454
72 Ga0451577_0012170 3300042876 Bacteria 8090
73 Ga0451577_0037503 3300042876 Bacteria 4362
74 Ga0451577_0099087 3300042876 Bacteria 2603
75 Ga0451577_0131775 3300042876 Bacteria 2243
76 Ga0451577_0317946 3300042876 Bacteria 1411
77 Ga0451577_0358815 3300042876 Bacteria 1322
78 Ga0453683_0000227 3300044673 Bacteria 75124
79 Ga0453683_0000768 3300044673 Bacteria 31862
80 Ga0453683_0001274 3300044673 Bacteria 22351
81 Ga0453683_0003299 3300044673 Bacteria 11953
82 Ga0453683_0007933 3300044673 Bacteria 7155
83 Ga0453683_0012485 3300044673 Bacteria 5566
84 Ga0453683_0183513 3300044673 Bacteria 1327
85 Ga0453683_0237494 3300044673 Unclassified 1160
86 Ga0466964_0018309 3300044706 Bacteria 2687
87 Ga0453684_0000191 3300044712 Bacteria 267816
88 Ga0453684_0000469 3300044712 Bacteria 160413
89 Ga0453684_0001194 3300044712 Bacteria 80254
90 Ga0453684_0001431 3300044712 Bacteria 68233
91 Ga0453684_0002120 3300044712 Bacteria 49982
92 Ga0453684_0002228 3300044712 Bacteria 48078
93 Ga0453684_0002542 3300044712 Bacteria 43901
94 Ga0453684_0004010 3300044712 Bacteria 32091
95 Ga0453684_0004774 3300044712 Bacteria 27951
96 Ga0453684_0007580 3300044712 Bacteria 19896
97 Ga0453684_0013670 3300044712 Bacteria 13150
98 Ga0453684_0017548 3300044712 Bacteria 11076
99 Ga0453684_0020937 3300044712 Bacteria 9810
100 Ga0453684_0062225 3300044712 Bacteria 4782
101 Ga0453684_0115763 3300044712 Bacteria 3248
102 Ga0453684_0126206 3300044712 Bacteria 3079
103 Ga0453684_0223729 3300044712 Bacteria 2178
104 Ga0453684_0349164 3300044712 Bacteria 1669
105 Ga0451576_0000297 3300045051 Bacteria 120836
106 Ga0451576_0001102 3300045051 Bacteria 49331
107 Ga0451576_0001626 3300045051 Bacteria 37654
108 Ga0451576_0001722 3300045051 Bacteria 36067
109 Ga0451576_0003347 3300045051 Bacteria 22204
110 Ga0451576_0004908 3300045051 Bacteria 17065
111 Ga0451576_0004911 3300045051 Bacteria 17059
112 Ga0451576_0005792 3300045051 Bacteria 15366
113 Ga0451576_0009708 3300045051 Bacteria 11130
114 Ga0451576_0017429 3300045051 Bacteria 7897
115 Ga0451576_0033783 3300045051 Bacteria 5435
116 Ga0451576_0037098 3300045051 Bacteria 5164
117 Ga0451576_0055156 3300045051 Bacteria 4159
118 Ga0451576_0176100 3300045051 Bacteria 2233
119 Ga0451576_0458887 3300045051 Unclassified 1338
120 Ga0495638_0000020 3300046460 Bacteria 372434
121 Ga0495597_0099605 3300046542 Bacteria 1227
122 Ga0501242_000704 3300049674 Unclassified 3083
123 Ga0501247_002117 3300049677 Unclassified 2031
124 Ga0501257_010384 3300049686 Unclassified 2113
125 Ga0501264_000192 3300049761 Bacteria 9804
126 nmdc:mga08y16_125744_c1 3300050511 Unclassified 2667
127 Ga0500583_0067164 3300053092 Unclassified 1708
128 Ga0500618_001942 3300053125 Bacteria 8487
129 Ga0500655_005563 3300053133 Unclassified 2270
130 Ga0500655_009152 3300053133 Unclassified 1783
131 Ga0500604_0000371 3300053151 Bacteria 12294
132 Ga0500616_0000004 3300053153 Bacteria 1002714
133 Ga0500616_0008019 3300053153 Bacteria 6615
134 Ga0500622_0000014 3300053156 Bacteria 368189
135 Ga0500622_0000020 3300053156 Bacteria 271239
136 Ga0500622_0022644 3300053156 Bacteria 3328
137 Ga0105239_10032119
138 JGI25162J39368_1000137
139 rootH1_10002106
140 rootH1_10020816
141 rootH1_10108128
142 rootH2_10006168
143 rootH2_10155247
144 rootL2_10000158
145 rootL2_10151806
146 rootL2_10182522
147 rootL2_10245536
148 rootL2_10253416
149 rootH1_10009752
150 rootH1_10028721
151 rootH1_10031428
152 rootH1_10034368
153 rootH1_10053290
154 rootH1_10101639
155 rootH1_10130046
156 rootH1_10279879
157 Ga0055531_10000223
158 Ga0065165_1001877
159 Ga0070680_100083793
160 Ga0070665_100389852
161 Ga0068855_100238895
162 Ga0068856_100090035
163 Ga0105240_10243221
164 Ga0105240_10324548
165 Ga0111539_10002515
166 Ga0111539_10011557
167 Ga0105239_10034106
168 Ga0157372_10056567
169 Ga0209437_100143
170 Ga0209129_1010249
171 Ga0209050_1006797
172 Ga0209257_1000005
173 Ga0207695_10254896
174 Ga0207671_10011166
175 Ga0207671_10024308
176 Ga0207660_10273998
177 Ga0207667_10031706
178 Ga0207702_10067391
179 Ga0268266_10333551
180 Ga0265334_10014998
181 Ga0265323_10000283
182 Ga0265323_10002273
183 Ga0265336_10011149
184 Ga0265338_10060036
185 Ga0265327_10046195
186 Ga0265327_10049172
187 Ga0265316_10003867
188 Ga0265316_10008318
189 Ga0307408_100003975
190 Ga0316576_10037919
191 Ga0316576_10113100
192 Ga0316576_10127878
193 Ga0307516_10221296
194 Ga0307405_10095948
195 Ga0307413_10040469
196 Ga0307412_10010343
197 Ga0307412_10322437
198 Ga0307416_100028150
199 Ga0307416_100276654
200 Ga0316574_0101550
201 Ga0316574_0117970
202 Ga0400483_259523
203 Ga0451577_0000010
204 Ga0451577_0000754
205 Ga0451577_0001692
206 Ga0451577_0012170
207 Ga0451577_0037503
208 Ga0451577_0099087
209 Ga0451577_0131775
210 Ga0451577_0317946
211 Ga0451577_0358815
212 Ga0453683_0000227
213 Ga0453683_0000768
214 Ga0453683_0001274
215 Ga0453683_0003299
216 Ga0453683_0007933
217 Ga0453683_0012485
218 Ga0453683_0183513
219 Ga0453683_0237494
220 Ga0466964_0018309
221 Ga0453684_0000191
222 Ga0453684_0000469
223 Ga0453684_0001194
224 Ga0453684_0001431
225 Ga0453684_0002120
226 Ga0453684_0002228
227 Ga0453684_0002542
228 Ga0453684_0004010
229 Ga0453684_0004774
230 Ga0453684_0007580
231 Ga0453684_0013670
232 Ga0453684_0017548
233 Ga0453684_0020937
234 Ga0453684_0062225
235 Ga0453684_0115763
236 Ga0453684_0126206
237 Ga0453684_0223729
238 Ga0453684_0349164
239 Ga0451576_0000297
240 Ga0451576_0001102
241 Ga0451576_0001626
242 Ga0451576_0001722
243 Ga0451576_0003347
244 Ga0451576_0004908
245 Ga0451576_0004911
246 Ga0451576_0005792
247 Ga0451576_0009708
248 Ga0451576_0017429
249 Ga0451576_0033783
250 Ga0451576_0037098
251 Ga0451576_0055156
252 Ga0451576_0176100
253 Ga0451576_0458887
254 Ga0495638_0000020
255 Ga0495597_0099605
256 Ga0501242_000704
257 Ga0501247_002117
258 Ga0501257_010384
259 Ga0501264_000192
260 nmdc:mga08y16_125744_c1
261 Ga0500583_0067164
262 Ga0500618_001942
263 Ga0500655_005563
264 Ga0500655_009152
265 Ga0500604_0000371
266 Ga0500616_0000004
267 Ga0500616_0008019
268 Ga0500622_0000014
269 Ga0500622_0000020
270 Ga0500622_0022644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00356

LacI

Bacterial regulatory proteins, lacI family

77

122

0.98

PF13377

Peripla_BP_3

Periplasmic binding protein-like domain

244

405

0.94

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

133

403

0.89

PF13407

Peripla_BP_4

Periplasmic binding protein domain

136

387

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3egc-assembly3.cif.gz_F crystal structure of a putative ribose operon repressor from burkholderia thailandensis 0.9401 70 337
3egc-assembly3.cif.gz_E crystal structure of a putative ribose operon repressor from burkholderia thailandensis 0.9395 70 337
2o20-assembly1.cif.gz_A crystal structure of transcription regulator ccpa of lactococcus lactis 0.9377 68 342
2o20-assembly1.cif.gz_A crystal structure of transcription regulator ccpa of lactococcus lactis 0.9311 68 342
3egc-assembly3.cif.gz_F crystal structure of a putative ribose operon repressor from burkholderia thailandensis 0.9264 70 337
ID Description Score Start End Superfamily
3kkeB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9562 174 300 3.40.50.2300
3k4hB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9504 174 300 3.40.50.2300
2o20A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9423 174 300 3.40.50.2300
1jhzB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.942 174 300 3.40.50.2300
2rgyA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9411 172 300 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3C0ZNV9-F1-model_v4 Transcriptional regulator LacI/GalR-like sensor domain-containing protein 0.969 85 347 GO:0000976
GO:0003700
AF-A0A1E4A2L6-F1-model_v4 LacI family transcriptional regulator 0.9669 101 343 GO:0000976
GO:0003700
AF-A0A532V423-F1-model_v4 LacI family transcriptional regulator 0.9601 173 342 GO:0000976
GO:0003700
AF-A0A1E4A2L6-F1-model_v4 LacI family transcriptional regulator 0.9591 101 343 GO:0000976
GO:0003700
AF-A0A7H4P3Q3-F1-model_v4 Regulatory protein 0.9494 167 341 GO:0000976
GO:0003700

Map