F159802

General Info

Members Datasets Scaffolds Average Seq Length
134 112 268 173

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10166080|Ga0157369_101660802
Length 207
Sequence MIGLFMLAMIKKIIKQSFFIKYFDSNYIAYMFWSMKNIIIRVATNKDAALIADLSRETFFNAFSPFNTKEDMDKFMNEVFTREKLIAELDLPDNIFLIAYAGNDVAGYVRLRDRNIPEVSPGTGNVIEIARIYTATSEMAKGIGTALIQECISIAKRKQRDYIWLGVWEKNDKAIRFYERFGFKRFGEHEFLLGSDRQTDWLMMLKL

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
79 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
80 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
81 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
82 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
83 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
86 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
87 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
88 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
99 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
100 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
101 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
104 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
105 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
106 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
107 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
108 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
109 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
110 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
111 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
112 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.19
Nodule 0
Rhizoplane 1.49
Rhizosphere 76.87
Stem 0
Stem Tuber 0
Unclassified 21.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10166080 3300013105 Bacteria 2328
2 rootL2_10025363 3300003322 Bacteria 3343
3 rootL2_10165072 3300003322 Bacteria 2795
4 rootH1_10046150 3300003323 Bacteria 23249
5 rootH1_10224078 3300003323 Bacteria 1771
6 Ga0070676_10880395 3300005328 Bacteria 666
7 Ga0070670_100147248 3300005331 Bacteria 2037
8 Ga0068869_100921418 3300005334 Bacteria 757
9 Ga0070666_10118117 3300005335 Unclassified 1838
10 Ga0068868_100935919 3300005338 Bacteria 789
11 Ga0070689_100067709 3300005340 Unclassified 2784
12 Ga0070687_100755495 3300005343 Unclassified 685
13 Ga0070668_100064506 3300005347 Bacteria 2839
14 Ga0070668_100112135 3300005347 Unclassified 2171
15 Ga0070669_100655979 3300005353 Bacteria 883
16 Ga0070675_100258787 3300005354 Bacteria 1524
17 Ga0070671_100275341 3300005355 Bacteria 1431
18 Ga0070674_100010620 3300005356 Bacteria 5576
19 Ga0070674_100560128 3300005356 Bacteria 960
20 Ga0070688_100757021 3300005365 Unclassified 757
21 Ga0070667_100015790 3300005367 Bacteria 6246
22 Ga0070667_100248699 3300005367 Bacteria 1589
23 Ga0070678_100067293 3300005456 Unclassified 2665
24 Ga0070685_10130727 3300005466 Bacteria 1569
25 Ga0070672_101542888 3300005543 Bacteria 595
26 Ga0070686_100699163 3300005544 Unclassified 808
27 Ga0068859_100027097 3300005617 Bacteria 5749
28 Ga0068861_100015779 3300005719 Bacteria 5332
29 Ga0068860_100013417 3300005843 Bacteria 8037
30 Ga0068860_100644741 3300005843 Bacteria 1067
31 Ga0068862_100445548 3300005844 Bacteria 1220
32 Ga0081539_10227941 3300005985 Bacteria 843
33 Ga0075366_10079475 3300006195 Bacteria 1958
34 Ga0075366_10175475 3300006195 Unclassified 1301
35 Ga0097621_100017290 3300006237 Bacteria 5473
36 Ga0075370_10472926 3300006353 Bacteria 755
37 Ga0068865_100040120 3300006881 Unclassified 3179
38 Ga0097620_100027097 3300006931 Bacteria 5749
39 Ga0114129_10010411 3300009147 Bacteria 13263
40 Ga0105243_10232124 3300009148 Bacteria 1637
41 Ga0105241_10063088 3300009174 Unclassified 2858
42 Ga0105242_10161685 3300009176 Unclassified 1961
43 Ga0105242_10257771 3300009176 Bacteria 1574
44 Ga0105242_10309856 3300009176 Bacteria 1444
45 Ga0105249_10235799 3300009553 Bacteria 1807
46 Ga0105249_10264176 3300009553 Bacteria 1712
47 Ga0105239_10027823 3300010375 Bacteria 6220
48 Ga0105246_10049601 3300011119 Bacteria 2875
49 Ga0157371_11096004 3300013102 Bacteria 610
50 Ga0157370_11495076 3300013104 Unclassified 607
51 Ga0157374_10025575 3300013296 Bacteria 5303
52 Ga0157374_10074470 3300013296 Bacteria 3206
53 Ga0157378_10023216 3300013297 Bacteria 5459
54 Ga0157378_10037261 3300013297 Bacteria 4306
55 Ga0157378_10167806 3300013297 Bacteria 2057
56 Ga0157378_10945174 3300013297 Bacteria 894
57 Ga0163162_10061644 3300013306 Bacteria 3788
58 Ga0157375_10470313 3300013308 Bacteria 1422
59 Ga0163163_10112941 3300014325 Bacteria 2746
60 Ga0163163_10558446 3300014325 Bacteria 1207
61 Ga0157380_10979246 3300014326 Bacteria 878
62 Ga0157376_11244087 3300014969 Bacteria 773
63 Ga0163161_10162883 3300017792 Bacteria 1701
64 Ga0209258_108674 3300025242 Bacteria 1410
65 Ga0207642_10087493 3300025899 Bacteria 1530
66 Ga0207645_10007807 3300025907 Bacteria 7527
67 Ga0207650_10192646 3300025925 Bacteria 1629
68 Ga0207709_10145561 3300025935 Bacteria 1634
69 Ga0207670_10093171 3300025936 Bacteria 2134
70 Ga0207691_10020894 3300025940 Bacteria 6185
71 Ga0207689_10077260 3300025942 Bacteria 2737
72 Ga0207712_10148589 3300025961 Bacteria 1807
73 Ga0207668_10173514 3300025972 Bacteria 1693
74 Ga0207640_10877260 3300025981 Bacteria 782
75 Ga0207658_10022434 3300025986 Unclassified 4395
76 Ga0207658_10085235 3300025986 Bacteria 2433
77 Ga0207677_10282046 3300026023 Bacteria 1364
78 Ga0207639_10118978 3300026041 Bacteria 2167
79 Ga0207641_10874050 3300026088 Bacteria 892
80 Ga0207648_10017576 3300026089 Bacteria 6497
81 Ga0207676_11096799 3300026095 Unclassified 787
82 Ga0207675_100029077 3300026118 Bacteria 5150
83 Ga0207675_100106487 3300026118 Bacteria 2644
84 Ga0207683_10005321 3300026121 Bacteria 11037
85 Ga0268266_11331150 3300028379 Unclassified 694
86 Ga0268265_10476969 3300028380 Bacteria 1171
87 Ga0268264_10009488 3300028381 Bacteria 8058
88 Ga0307517_10483452 3300028786 Unclassified 634
89 Ga0307511_10000265 3300030521 Bacteria 54237
90 Ga0265327_10031175 3300031251 Bacteria 3000
91 Ga0307509_10121017 3300031507 Unclassified 2595
92 Ga0307516_10221836 3300031730 Bacteria 1599
93 Ga0307516_10279154 3300031730 Bacteria 1353
94 Ga0307516_10317754 3300031730 Unclassified 1229
95 Ga0307414_10939916 3300032004 Bacteria 794
96 Ga0373936_0044055 3300035113 Unclassified 1795
97 Ga0439436_0047761 3300041404 Bacteria 1215
98 Ga0439439_0031000 3300041406 Bacteria 1361
99 Ga0451791_1549005 3300041451 Bacteria 1847
100 Ga0451795_1534113 3300041456 Bacteria 1150
101 Ga0451841_0185985 3300041498 Unclassified 2302
102 Ga0451843_0858433 3300041509 Bacteria 909
103 Ga0451853_2006780 3300041512 Unclassified 1205
104 Ga0439431_0041799 3300041997 Bacteria 1170
105 Ga0439445_0058948 3300042004 Bacteria 1047
106 Ga0439449_0007057 3300042007 Bacteria 4281
107 Ga0439449_0074576 3300042007 Bacteria 1250
108 Ga0439457_000239 3300042014 Bacteria 14798
109 Ga0466972_0000584 3300044658 Bacteria 17736
110 Ga0466965_0332781 3300044683 Unclassified 829
111 Ga0453684_1380159 3300044712 Unclassified 732
112 Ga0466968_0018377 3300044735 Bacteria 2804
113 Ga0495650_0071495 3300046471 Bacteria 1360
114 Ga0495580_0327802 3300046472 Bacteria 1040
115 Ga0495674_0327966 3300047319 Bacteria 1246
116 Ga0495686_0023148 3300047472 Bacteria 4101
117 Ga0501038_0960189 3300049574 Bacteria 629
118 Ga0501217_048193 3300049661 Bacteria 1106
119 Ga0501257_057346 3300049686 Unclassified 980
120 Ga0501257_062825 3300049686 Unclassified 940
121 Ga0501225_0001196 3300049705 Bacteria 8108
122 nmdc:mga0k408_74912_c1 3300050493 Bacteria 1977
123 nmdc:mga05p37_7303_c1 3300050507 Bacteria 13034
124 Ga0500578_0000029 3300053086 Bacteria 140078
125 Ga0500644_0396743 3300053088 Unclassified 601
126 Ga0500583_0000002 3300053092 Bacteria 232826
127 Ga0500583_0001313 3300053092 Bacteria 7097
128 Ga0500651_0342426 3300053093 Unclassified 850
129 Ga0500650_0008064 3300053098 Unclassified 4143
130 Ga0500572_105355 3300053111 Bacteria 904
131 Ga0500658_0165803 3300053134 Unclassified 1002
132 Ga0500622_0057642 3300053156 Bacteria 1986
133 Ga0500639_136620 3300053163 Bacteria 1153
134 2738728288 2738541278 Bacteria 9755573
135 Ga0157369_10166080
136 rootL2_10025363
137 rootL2_10165072
138 rootH1_10046150
139 rootH1_10224078
140 Ga0070676_10880395
141 Ga0070670_100147248
142 Ga0068869_100921418
143 Ga0070666_10118117
144 Ga0068868_100935919
145 Ga0070689_100067709
146 Ga0070687_100755495
147 Ga0070668_100064506
148 Ga0070668_100112135
149 Ga0070669_100655979
150 Ga0070675_100258787
151 Ga0070671_100275341
152 Ga0070674_100010620
153 Ga0070674_100560128
154 Ga0070688_100757021
155 Ga0070667_100015790
156 Ga0070667_100248699
157 Ga0070678_100067293
158 Ga0070685_10130727
159 Ga0070672_101542888
160 Ga0070686_100699163
161 Ga0068859_100027097
162 Ga0068861_100015779
163 Ga0068860_100013417
164 Ga0068860_100644741
165 Ga0068862_100445548
166 Ga0081539_10227941
167 Ga0075366_10079475
168 Ga0075366_10175475
169 Ga0097621_100017290
170 Ga0075370_10472926
171 Ga0068865_100040120
172 Ga0097620_100027097
173 Ga0114129_10010411
174 Ga0105243_10232124
175 Ga0105241_10063088
176 Ga0105242_10161685
177 Ga0105242_10257771
178 Ga0105242_10309856
179 Ga0105249_10235799
180 Ga0105249_10264176
181 Ga0105239_10027823
182 Ga0105246_10049601
183 Ga0157371_11096004
184 Ga0157370_11495076
185 Ga0157374_10025575
186 Ga0157374_10074470
187 Ga0157378_10023216
188 Ga0157378_10037261
189 Ga0157378_10167806
190 Ga0157378_10945174
191 Ga0163162_10061644
192 Ga0157375_10470313
193 Ga0163163_10112941
194 Ga0163163_10558446
195 Ga0157380_10979246
196 Ga0157376_11244087
197 Ga0163161_10162883
198 Ga0209258_108674
199 Ga0207642_10087493
200 Ga0207645_10007807
201 Ga0207650_10192646
202 Ga0207709_10145561
203 Ga0207670_10093171
204 Ga0207691_10020894
205 Ga0207689_10077260
206 Ga0207712_10148589
207 Ga0207668_10173514
208 Ga0207640_10877260
209 Ga0207658_10022434
210 Ga0207658_10085235
211 Ga0207677_10282046
212 Ga0207639_10118978
213 Ga0207641_10874050
214 Ga0207648_10017576
215 Ga0207676_11096799
216 Ga0207675_100029077
217 Ga0207675_100106487
218 Ga0207683_10005321
219 Ga0268266_11331150
220 Ga0268265_10476969
221 Ga0268264_10009488
222 Ga0307517_10483452
223 Ga0307511_10000265
224 Ga0265327_10031175
225 Ga0307509_10121017
226 Ga0307516_10221836
227 Ga0307516_10279154
228 Ga0307516_10317754
229 Ga0307414_10939916
230 Ga0373936_0044055
231 Ga0439436_0047761
232 Ga0439439_0031000
233 Ga0451791_1549005
234 Ga0451795_1534113
235 Ga0451841_0185985
236 Ga0451843_0858433
237 Ga0451853_2006780
238 Ga0439431_0041799
239 Ga0439445_0058948
240 Ga0439449_0007057
241 Ga0439449_0074576
242 Ga0439457_000239
243 Ga0466972_0000584
244 Ga0466965_0332781
245 Ga0453684_1380159
246 Ga0466968_0018377
247 Ga0495650_0071495
248 Ga0495580_0327802
249 Ga0495674_0327966
250 Ga0495686_0023148
251 Ga0501038_0960189
252 Ga0501217_048193
253 Ga0501257_057346
254 Ga0501257_062825
255 Ga0501225_0001196
256 nmdc:mga0k408_74912_c1
257 nmdc:mga05p37_7303_c1
258 Ga0500578_0000029
259 Ga0500644_0396743
260 Ga0500583_0000002
261 Ga0500583_0001313
262 Ga0500651_0342426
263 Ga0500650_0008064
264 Ga0500572_105355
265 Ga0500658_0165803
266 Ga0500622_0057642
267 Ga0500639_136620
268 2738728288

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

63

194

0.95

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

56

183

0.85

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

92

185

0.82

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

37

184

0.8

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

40

200

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.9224 1 172
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.9173 1 172
1tiq-assembly2.cif.gz_B crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.905 3 172
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.8747 3 172
3fnc-assembly1.cif.gz_B crystal structure of a putative acetyltransferase from listeria innocua 0.8713 1 172
ID Description Score Start End Superfamily
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9042 124 172 3.40.630.30
af_Q2G0G4_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8963 3 168 3.40.630.30
1tiqB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8959 3 172 3.40.630.30
af_Q2FVQ1_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8945 5 172 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8911 111 172 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A537ILB0-F1-model_v4 GNAT family N-acetyltransferase 0.9793 3 171 GO:0016747
AF-A0A4Q5UNU4-F1-model_v4 deleted 0.9763 2 171
AF-A0A4Q5SU11-F1-model_v4 GNAT family N-acetyltransferase 0.9732 2 171 GO:0016747
AF-A0A4Q5WUA8-F1-model_v4 GNAT family N-acetyltransferase 0.9709 2 172 GO:0016747
AF-A0A4Q5UHB9-F1-model_v4 GNAT family N-acetyltransferase 0.9616 2 172 GO:0016747

Map