F166388

General Info

Members Datasets Scaffolds Average Seq Length
136 105 272 212

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10095468|Ga0111539_100954683
Length 244
Sequence MLALLWLARAVGIAQRAYVIVLFVTTVVLVAYLLGSIPFGLIVGKSQGIDVRDHGSRNIGATNVWRVLGKKFGLLTFFCDAAKGWLAVVLGIWIYEHWNWLLFEPTLTHVIVPWDQGVAGILAAIGCILGHNFPVWLEFKGGKGVATSLGVIVGMMPLAALIVFAIWGIVFKISRYVSLASLVAAVALPVTVLGLMFAGQIRGWSFFYFSCAXXXXVIRRHRENIKRLVAGTENRFGRKEESTE

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
66 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
71 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
72 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
80 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
90 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
91 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
92 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
93 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
94 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
105 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 0
Rhizoplane 11.76
Rhizosphere 82.35
Stem 0
Stem Tuber 0
Unclassified 16.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10095468 3300009094 Bacteria 3493
2 Ga0065707_10090227 3300005295 Bacteria 4183
3 Ga0070658_10022576 3300005327 Bacteria 5050
4 Ga0070658_10348098 3300005327 Bacteria 1268
5 Ga0070658_10677800 3300005327 Bacteria 895
6 Ga0070683_100879815 3300005329 Bacteria 859
7 Ga0070670_100284698 3300005331 Unclassified 1443
8 Ga0068869_100070293 3300005334 Unclassified 2590
9 Ga0070671_100344690 3300005355 Bacteria 1271
10 Ga0070659_100021678 3300005366 Unclassified 4898
11 Ga0070667_100176303 3300005367 Bacteria 1889
12 Ga0070714_100397874 3300005435 Bacteria 1301
13 Ga0070710_10470987 3300005437 Bacteria 855
14 Ga0070711_100176006 3300005439 Bacteria 1634
15 Ga0070705_100071002 3300005440 Bacteria 2105
16 Ga0070698_100002090 3300005471 Bacteria 22153
17 Ga0070697_100000055 3300005536 Bacteria 86691
18 Ga0068853_100000044 3300005539 Bacteria 100605
19 Ga0070686_100048704 3300005544 Unclassified 2685
20 Ga0070665_100000130 3300005548 Bacteria 141805
21 Ga0070704_100133173 3300005549 Bacteria 1930
22 Ga0068855_100003334 3300005563 Bacteria 19648
23 Ga0068857_100330899 3300005577 Bacteria 1408
24 Ga0068852_100226818 3300005616 Unclassified 1779
25 Ga0068852_100265376 3300005616 Bacteria 1650
26 Ga0068866_10118518 3300005718 Bacteria 1488
27 Ga0081539_10000187 3300005985 Bacteria 145407
28 Ga0081539_10033571 3300005985 Bacteria 3122
29 Ga0070715_10014535 3300006163 Bacteria 2917
30 Ga0097621_100668856 3300006237 Bacteria 954
31 Ga0075430_100500223 3300006846 Unclassified 1003
32 Ga0075433_10001158 3300006852 Bacteria 19165
33 Ga0075433_10406374 3300006852 Unclassified 1201
34 Ga0075434_100001983 3300006871 Bacteria 17751
35 Ga0105240_10000053 3300009093 Bacteria 225578
36 Ga0105240_10006333 3300009093 Bacteria 17422
37 Ga0105240_10034166 3300009093 Bacteria 6562
38 Ga0105240_10061349 3300009093 Bacteria 4686
39 Ga0105245_10030757 3300009098 Bacteria 4748
40 Ga0114129_10011607 3300009147 Bacteria 12542
41 Ga0114129_10236336 3300009147 Unclassified 2458
42 Ga0114129_10533180 3300009147 Bacteria 1529
43 Ga0114129_10685878 3300009147 Bacteria 1318
44 Ga0105243_10040295 3300009148 Bacteria 3647
45 Ga0105243_10888332 3300009148 Bacteria 885
46 Ga0105241_10227288 3300009174 Bacteria 1571
47 Ga0105238_10029981 3300009551 Bacteria 5537
48 Ga0105239_10080082 3300010375 Unclassified 3594
49 Ga0105239_10564454 3300010375 Bacteria 1297
50 Ga0105239_11088887 3300010375 Unclassified 920
51 Ga0157370_10149583 3300013104 Bacteria 2173
52 Ga0157370_10523253 3300013104 Bacteria 1088
53 Ga0157370_10741500 3300013104 Unclassified 895
54 Ga0157370_10769635 3300013104 Bacteria 877
55 Ga0157369_10004534 3300013105 Bacteria 16345
56 Ga0157369_10051140 3300013105 Bacteria 4472
57 Ga0157374_10189238 3300013296 Bacteria 2013
58 Ga0163162_10386855 3300013306 Bacteria 1532
59 Ga0157372_10000659 3300013307 Bacteria 37935
60 Ga0163163_10021767 3300014325 Bacteria 6057
61 Ga0163163_10151894 3300014325 Bacteria 2359
62 Ga0163163_10323613 3300014325 Unclassified 1595
63 Ga0209050_1012311 3300025298 Bacteria 3937
64 Ga0207685_10234551 3300025905 Bacteria 880
65 Ga0207684_10076327 3300025910 Bacteria 2848
66 Ga0207654_10124402 3300025911 Bacteria 1624
67 Ga0207695_10000590 3300025913 Bacteria 73193
68 Ga0207695_10021131 3300025913 Bacteria 7435
69 Ga0207695_10540258 3300025913 Unclassified 1047
70 Ga0207693_10136466 3300025915 Bacteria 1929
71 Ga0207663_10228085 3300025916 Bacteria 1359
72 Ga0207660_10077562 3300025917 Bacteria 2433
73 Ga0207652_10208713 3300025921 Unclassified 1758
74 Ga0207694_10018855 3300025924 Bacteria 5215
75 Ga0207650_10061795 3300025925 Bacteria 2797
76 Ga0207650_10101120 3300025925 Unclassified 2219
77 Ga0207687_10550234 3300025927 Bacteria 968
78 Ga0207700_10210831 3300025928 Bacteria 1642
79 Ga0207690_10179753 3300025932 Bacteria 1592
80 Ga0207689_10011082 3300025942 Bacteria 7748
81 Ga0207667_10304122 3300025949 Bacteria 1629
82 Ga0207703_10001557 3300026035 Bacteria 20784
83 Ga0207639_10000041 3300026041 Bacteria 142289
84 Ga0207641_10000717 3300026088 Bacteria 35616
85 Ga0207648_10483411 3300026089 Bacteria 1131
86 Ga0268266_10000136 3300028379 Bacteria 141853
87 Ga0307511_10000055 3300030521 Bacteria 93861
88 Ga0316182_1026381 3300030745 Bacteria 756
89 Ga0265328_10000043 3300031239 Bacteria 89024
90 Ga0395899_0203651 3300037312 Unclassified 1378
91 Ga0395900_0068916 3300037418 Bacteria 3635
92 Ga0395898_0218438 3300037466 Bacteria 1818
93 Ga0436360_1067136 3300039438 Bacteria 2112
94 Ga0451795_1555886 3300041456 Bacteria 859
95 Ga0451807_0452913 3300041486 Unclassified 751
96 Ga0451853_0973024 3300041512 Unclassified 892
97 Ga0466959_0290108 3300045049 Bacteria 1122
98 Ga0466959_0410398 3300045049 Unclassified 920
99 Ga0451576_0016136 3300045051 Bacteria 8252
100 Ga0466958_0019468 3300045836 Bacteria 3951
101 Ga0466958_0127339 3300045836 Bacteria 1597
102 Ga0466967_0028715 3300045976 Bacteria 4648
103 Ga0495643_0000238 3300046522 Bacteria 82441
104 Ga0495675_0391320 3300047444 Unclassified 811
105 Ga0496102_0039660 3300048905 Bacteria 4256
106 Ga0496102_0128093 3300048905 Bacteria 2374
107 Ga0496105_0062021 3300048908 Bacteria 3085
108 Ga0496106_0306805 3300048909 Bacteria 1273
109 Ga0496108_0050778 3300048911 Bacteria 3473
110 Ga0496109_0029493 3300048912 Bacteria 4914
111 Ga0496109_0038173 3300048912 Bacteria 4341
112 Ga0496110_0029323 3300048913 Bacteria 4734
113 Ga0496111_0162645 3300048914 Bacteria 1657
114 Ga0496112_0586005 3300048915 Bacteria 1048
115 Ga0496113_0090845 3300048916 Bacteria 2353
116 Ga0496114_0011128 3300048917 Bacteria 7182
117 Ga0496114_0063701 3300048917 Bacteria 3087
118 Ga0496120_0059868 3300048923 Bacteria 2133
119 Ga0496122_0000011 3300048925 Bacteria 545274
120 Ga0496123_0001599 3300048926 Bacteria 30730
121 Ga0496126_0000002 3300048929 Bacteria 1001703
122 Ga0501300_006053 3300049523 Bacteria 1783
123 Ga0501034_0156432 3300049571 Unclassified 2253
124 Ga0501070_0514147 3300049586 Bacteria 961
125 Ga0501073_0411567 3300049589 Bacteria 934
126 Ga0501257_000144 3300049686 Bacteria 15686
127 Ga0501080_0267789 3300049742 Bacteria 1556
128 Ga0501280_002296 3300049776 Bacteria 3238
129 nmdc:mga05p37_305396_c1 3300050507 Bacteria 1888
130 nmdc:mga05p37_346512_c1 3300050507 Bacteria 1750
131 nmdc:mga05p37_706204_c1 3300050507 Unclassified 1119
132 nmdc:mga0qj67_635396_c1 3300050509 Unclassified 852
133 nmdc:mga0a205_401_c1 3300050515 Bacteria 33097
134 nmdc:mga0a205_756818_c1 3300050515 Bacteria 820
135 Ga0500616_0007820 3300053153 Bacteria 6733
136 2787437265 2786546517 Bacteria 6614109
137 Ga0111539_10095468
138 Ga0065707_10090227
139 Ga0070658_10022576
140 Ga0070658_10348098
141 Ga0070658_10677800
142 Ga0070683_100879815
143 Ga0070670_100284698
144 Ga0068869_100070293
145 Ga0070671_100344690
146 Ga0070659_100021678
147 Ga0070667_100176303
148 Ga0070714_100397874
149 Ga0070710_10470987
150 Ga0070711_100176006
151 Ga0070705_100071002
152 Ga0070698_100002090
153 Ga0070697_100000055
154 Ga0068853_100000044
155 Ga0070686_100048704
156 Ga0070665_100000130
157 Ga0070704_100133173
158 Ga0068855_100003334
159 Ga0068857_100330899
160 Ga0068852_100226818
161 Ga0068852_100265376
162 Ga0068866_10118518
163 Ga0081539_10000187
164 Ga0081539_10033571
165 Ga0070715_10014535
166 Ga0097621_100668856
167 Ga0075430_100500223
168 Ga0075433_10001158
169 Ga0075433_10406374
170 Ga0075434_100001983
171 Ga0105240_10000053
172 Ga0105240_10006333
173 Ga0105240_10034166
174 Ga0105240_10061349
175 Ga0105245_10030757
176 Ga0114129_10011607
177 Ga0114129_10236336
178 Ga0114129_10533180
179 Ga0114129_10685878
180 Ga0105243_10040295
181 Ga0105243_10888332
182 Ga0105241_10227288
183 Ga0105238_10029981
184 Ga0105239_10080082
185 Ga0105239_10564454
186 Ga0105239_11088887
187 Ga0157370_10149583
188 Ga0157370_10523253
189 Ga0157370_10741500
190 Ga0157370_10769635
191 Ga0157369_10004534
192 Ga0157369_10051140
193 Ga0157374_10189238
194 Ga0163162_10386855
195 Ga0157372_10000659
196 Ga0163163_10021767
197 Ga0163163_10151894
198 Ga0163163_10323613
199 Ga0209050_1012311
200 Ga0207685_10234551
201 Ga0207684_10076327
202 Ga0207654_10124402
203 Ga0207695_10000590
204 Ga0207695_10021131
205 Ga0207695_10540258
206 Ga0207693_10136466
207 Ga0207663_10228085
208 Ga0207660_10077562
209 Ga0207652_10208713
210 Ga0207694_10018855
211 Ga0207650_10061795
212 Ga0207650_10101120
213 Ga0207687_10550234
214 Ga0207700_10210831
215 Ga0207690_10179753
216 Ga0207689_10011082
217 Ga0207667_10304122
218 Ga0207703_10001557
219 Ga0207639_10000041
220 Ga0207641_10000717
221 Ga0207648_10483411
222 Ga0268266_10000136
223 Ga0307511_10000055
224 Ga0316182_1026381
225 Ga0265328_10000043
226 Ga0395899_0203651
227 Ga0395900_0068916
228 Ga0395898_0218438
229 Ga0436360_1067136
230 Ga0451795_1555886
231 Ga0451807_0452913
232 Ga0451853_0973024
233 Ga0466959_0290108
234 Ga0466959_0410398
235 Ga0451576_0016136
236 Ga0466958_0019468
237 Ga0466958_0127339
238 Ga0466967_0028715
239 Ga0495643_0000238
240 Ga0495675_0391320
241 Ga0496102_0039660
242 Ga0496102_0128093
243 Ga0496105_0062021
244 Ga0496106_0306805
245 Ga0496108_0050778
246 Ga0496109_0029493
247 Ga0496109_0038173
248 Ga0496110_0029323
249 Ga0496111_0162645
250 Ga0496112_0586005
251 Ga0496113_0090845
252 Ga0496114_0011128
253 Ga0496114_0063701
254 Ga0496120_0059868
255 Ga0496122_0000011
256 Ga0496123_0001599
257 Ga0496126_0000002
258 Ga0501300_006053
259 Ga0501034_0156432
260 Ga0501070_0514147
261 Ga0501073_0411567
262 Ga0501257_000144
263 Ga0501080_0267789
264 Ga0501280_002296
265 nmdc:mga05p37_305396_c1
266 nmdc:mga05p37_346512_c1
267 nmdc:mga05p37_706204_c1
268 nmdc:mga0qj67_635396_c1
269 nmdc:mga0a205_401_c1
270 nmdc:mga0a205_756818_c1
271 Ga0500616_0007820
272 2787437265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

30

228

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.9224 2 208
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.9115 2 208
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.8518 2 208
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.8367 2 208
3bqy-assembly1.cif.gz_A-2 crystal structure of a possible tetr family transcriptional regulator from streptomyces coelicolor a3(2). 0.3881 7 189
ID Description Score Start End Superfamily
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9001 1 198 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8966 1 198 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8904 1 198 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8873 1 198 1.10.1760.20
af_B0S8J9_9_88_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.5683 128 206 1.20.58.80
ID Description Score Start End GO Terms
AF-A0A7X9FQI7-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9787 2 208 GO:0004366
GO:0005886
GO:0008654
GO:0043772
AF-A0A661UET8-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9678 2 206 GO:0005886
GO:0008654
GO:0043772
AF-A0A3G1KNQ3-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9666 2 206 GO:0005886
GO:0008654
GO:0043772
AF-A0A7V9ZPL8-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9656 2 208 GO:0004366
GO:0005886
GO:0008654
GO:0043772
AF-A0A3E0KLE7-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9652 2 207 GO:0005886
GO:0008654
GO:0043772

Map