F167565

General Info

Members Datasets Scaffolds Average Seq Length
136 102 135 160

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0210120|Ga0495641_0210120_288_764
Length 158
Sequence MAKKRSAGILLYRVAGGGHEVLLVHPGGPFWSKKDLGAWSIPKGEIDEGEEPRACALRELEEELGTPPAIRLEQLIELGSVHQRAKVVEAWAAQADFDPETLASNTFSMEWPPRSGNEREFPEVDRAEWFAPDQARRKVIPAQAELIDRLLEHLEAPS

Samples

Sample ID Description Type Environment
1 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
72 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
73 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
74 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
77 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
78 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
79 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
82 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
85 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
86 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
87 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
90 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
99 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
100 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
101 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
102 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.88
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100003110 3300005329 Bacteria 13374
2 Ga0070683_100048296 3300005329 Bacteria 3935
3 Ga0070666_10005262 3300005335 Bacteria 7930
4 Ga0068868_100000388 3300005338 Bacteria 29915
5 Ga0070689_100060414 3300005340 Unclassified 2947
6 Ga0070661_100000226 3300005344 Bacteria 46716
7 Ga0070661_100086482 3300005344 Bacteria 2318
8 Ga0070668_100080711 3300005347 Bacteria 2549
9 Ga0070688_100000938 3300005365 Bacteria 14620
10 Ga0070688_100001077 3300005365 Bacteria 13688
11 Ga0070688_100058078 3300005365 Unclassified 2435
12 Ga0070659_100018092 3300005366 Bacteria 5313
13 Ga0070667_100103266 3300005367 Bacteria 2464
14 Ga0070714_100021483 3300005435 Bacteria 5282
15 Ga0070714_100521633 3300005435 Bacteria 1135
16 Ga0070713_100058651 3300005436 Unclassified 3211
17 Ga0070713_100195925 3300005436 Bacteria 1822
18 Ga0070713_100240166 3300005436 Unclassified 1649
19 Ga0070710_10310438 3300005437 Bacteria 1032
20 Ga0070701_10985512 3300005438 Unclassified 587
21 Ga0070678_100021121 3300005456 Bacteria 4287
22 Ga0070685_10001120 3300005466 Bacteria 14325
23 Ga0070685_10001211 3300005466 Bacteria 13721
24 Ga0070684_100072470 3300005535 Bacteria 3033
25 Ga0068853_100360114 3300005539 Bacteria 1355
26 Ga0068853_100373294 3300005539 Bacteria 1331
27 Ga0070665_100003494 3300005548 Bacteria 16731
28 Ga0070704_101656450 3300005549 Bacteria 590
29 Ga0068854_100000090 3300005578 Bacteria 64443
30 Ga0068856_100011706 3300005614 Bacteria 8508
31 Ga0068856_100014337 3300005614 Bacteria 7664
32 Ga0068852_100000006 3300005616 Bacteria 159569
33 Ga0068859_101662928 3300005617 Archaea 705
34 Ga0068851_10005809 3300005834 Bacteria 5620
35 Ga0068851_10020464 3300005834 Bacteria 3205
36 Ga0068870_10098979 3300005840 Bacteria 1644
37 Ga0068863_100026388 3300005841 Bacteria 5542
38 Ga0068865_100000023 3300006881 Bacteria 100785
39 Ga0097620_101663063 3300006931 Archaea 705
40 Ga0105245_10000662 3300009098 Bacteria 31191
41 Ga0105245_10005833 3300009098 Bacteria 10810
42 Ga0105247_10017523 3300009101 Bacteria 4296
43 Ga0105243_10008369 3300009148 Bacteria 7939
44 Ga0105248_10000008 3300009177 Bacteria 403910
45 Ga0105239_10054313 3300010375 Bacteria 4393
46 Ga0105239_10255956 3300010375 Bacteria 1967
47 Ga0157344_1013420 3300012476 Bacteria 628
48 Ga0157371_10014976 3300013102 Bacteria 5833
49 Ga0157370_10186575 3300013104 Bacteria 1925
50 Ga0157369_10000020 3300013105 Bacteria 241679
51 Ga0157369_11772755 3300013105 Bacteria 627
52 Ga0157372_10000253 3300013307 Bacteria 59272
53 Ga0157380_10000037 3300014326 Bacteria 80856
54 Ga0207656_10003166 3300025321 Bacteria 5627
55 Ga0207656_10013047 3300025321 Bacteria 3168
56 Ga0207710_10037460 3300025900 Bacteria 2142
57 Ga0207680_10014850 3300025903 Bacteria 4047
58 Ga0207663_10181701 3300025916 Unclassified 1503
59 Ga0207649_10000009 3300025920 Bacteria 295544
60 Ga0207649_10104359 3300025920 Bacteria 1882
61 Ga0207687_10000007 3300025927 Bacteria 604185
62 Ga0207687_10002930 3300025927 Bacteria 11590
63 Ga0207700_10000027 3300025928 Bacteria 137708
64 Ga0207700_10024883 3300025928 Bacteria 4150
65 Ga0207700_10098501 3300025928 Bacteria 2326
66 Ga0207664_10378854 3300025929 Bacteria 1256
67 Ga0207690_10008396 3300025932 Bacteria 6132
68 Ga0207709_10020286 3300025935 Bacteria 3747
69 Ga0207670_10053764 3300025936 Unclassified 2715
70 Ga0207704_10000068 3300025938 Bacteria 65896
71 Ga0207711_10000006 3300025941 Bacteria 792692
72 Ga0207661_10000056 3300025944 Bacteria 85250
73 Ga0207661_10034214 3300025944 Bacteria 3950
74 Ga0207661_10160746 3300025944 Bacteria 1949
75 Ga0207640_10000178 3300025981 Bacteria 46342
76 Ga0207677_10006661 3300026023 Bacteria 6341
77 Ga0207639_10027690 3300026041 Bacteria 4132
78 Ga0207639_10170460 3300026041 Bacteria 1843
79 Ga0207702_10000158 3300026078 Bacteria 79984
80 Ga0207702_10011880 3300026078 Bacteria 7249
81 Ga0207641_10036321 3300026088 Bacteria 4113
82 Ga0207683_10010441 3300026121 Bacteria 7923
83 Ga0207698_10000013 3300026142 Bacteria 255414
84 Ga0268266_10031179 3300028379 Bacteria 4526
85 Ga0268266_10081695 3300028379 Bacteria 2818
86 Ga0268266_10513278 3300028379 Bacteria 1145
87 Ga0307405_10680778 3300031731 Unclassified 849
88 Ga0307415_100008149 3300032126 Bacteria 5792
89 Ga0451807_1617527 3300041486 Bacteria 1086
90 Ga0466963_0022360 3300044694 Bacteria 4004
91 Ga0466957_0010176 3300044842 Bacteria 5384
92 Ga0466957_0261681 3300044842 Bacteria 1153
93 Ga0466957_0947970 3300044842 Bacteria 616
94 Ga0466958_0116195 3300045836 Bacteria 1672
95 Ga0466967_0000015 3300045976 Bacteria 99105
96 Ga0495592_0095211 3300046454 Unclassified 2130
97 Ga0495629_0040778 3300046459 Bacteria 3266
98 Ga0495641_0007588 3300046461 Bacteria 6751
99 Ga0495641_0210120 3300046461 Bacteria 872
100 Ga0495606_0000072 3300046507 Bacteria 173678
101 Ga0495608_0000060 3300046511 Bacteria 88189
102 Ga0495630_0000020 3300046517 Bacteria 176389
103 Ga0495630_0602277 3300046517 Unclassified 842
104 Ga0495652_0009453 3300046529 Bacteria 8857
105 Ga0495587_0000574 3300046536 Bacteria 25248
106 Ga0495645_0009915 3300046543 Bacteria 6667
107 Ga0495657_0000004 3300046675 Bacteria 266465
108 Ga0495599_0125525 3300046678 Bacteria 1595
109 Ga0495599_0304782 3300046678 Bacteria 961
110 Ga0495647_0003446 3300046681 Bacteria 5058
111 Ga0495658_0000607 3300046683 Bacteria 19616
112 Ga0495613_0000197 3300046689 Bacteria 59091
113 Ga0495624_0000179 3300046690 Bacteria 47140
114 Ga0495624_0257863 3300046690 Unclassified 1054
115 Ga0495604_0000155 3300047317 Bacteria 60014
116 Ga0495604_0018565 3300047317 Bacteria 5572
117 Ga0495675_0000040 3300047444 Bacteria 86266
118 Ga0495684_0640821 3300047471 Bacteria 712
119 Ga0495686_0071200 3300047472 Bacteria 2141
120 Ga0495593_0496972 3300047673 Bacteria 611
121 Ga0495602_0000070 3300048088 Bacteria 100656
122 Ga0496104_0313947 3300048907 Bacteria 1480
123 Ga0496108_0000146 3300048911 Bacteria 67618
124 Ga0496109_0000060 3300048912 Bacteria 115800
125 Ga0496110_0000021 3300048913 Bacteria 77064
126 Ga0496111_0000009 3300048914 Bacteria 93943
127 Ga0496112_0000153 3300048915 Bacteria 43240
128 Ga0496113_0000004 3300048916 Bacteria 109489
129 Ga0495601_0207477 3300053077 Bacteria 1280
130 Ga0495612_0155124 3300053078 Bacteria 998
131 Ga0495655_0001238 3300053083 Bacteria 3950
132 Ga0495595_0000003 3300053084 Bacteria 266465
133 Ga0495595_0007967 3300053084 Bacteria 4339
134 Ga0495595_0300995 3300053084 Bacteria 807
135 Ga0495619_0000137 3300053085 Bacteria 54479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047471 Ga0495684_0640821 Ga0495684_0640821_27_443 138
2 3300005338 Ga0068868_100000388 Ga0068868_1000003883 150
3 3300026023 Ga0207677_10006661 Ga0207677_100066614 150
4 iso_pu_bacteria 2937843397 2937843963 150
5 3300005329 Ga0070683_100048296 Ga0070683_1000482961 154
6 3300005344 Ga0070661_100086482 Ga0070661_1000864822 154
7 3300025920 Ga0207649_10104359 Ga0207649_101043591 154
8 3300025944 Ga0207661_10034214 Ga0207661_100342145 154
9 3300005340 Ga0070689_100060414 Ga0070689_1000604142 155
10 3300005365 Ga0070688_100058078 Ga0070688_1000580782 155
11 3300025936 Ga0207670_10053764 Ga0207670_100537642 155
12 3300045976 Ga0466967_0000015 Ga0466967_0000015_43526_43993 155
13 3300005347 Ga0070668_100080711 Ga0070668_1000807112 156
14 3300005435 Ga0070714_100021483 Ga0070714_1000214835 156
15 3300009148 Ga0105243_10008369 Ga0105243_100083695 156
16 3300012476 Ga0157344_1013420 Ga0157344_10134202 156
17 3300025935 Ga0207709_10020286 Ga0207709_100202863 156
18 3300046517 Ga0495630_0602277 Ga0495630_0602277_137_607 156
19 3300046536 Ga0495587_0000574 Ga0495587_0000574_9996_10466 156
20 3300046681 Ga0495647_0003446 Ga0495647_0003446_325_795 156
21 3300046690 Ga0495624_0000179 Ga0495624_0000179_40146_40616 156
22 3300053083 Ga0495655_0001238 Ga0495655_0001238_260_730 156
23 3300053084 Ga0495595_0300995 Ga0495595_0300995_184_654 156
24 3300005438 Ga0070701_10985512 Ga0070701_109855121 157
25 3300005539 Ga0068853_100360114 Ga0068853_1003601142 157
26 3300005616 Ga0068852_100000006 Ga0068852_10000000688 157
27 3300006881 Ga0068865_100000023 Ga0068865_10000002330 157
28 3300025938 Ga0207704_10000068 Ga0207704_1000006846 157
29 3300026142 Ga0207698_10000013 Ga0207698_10000013101 157
30 3300044694 Ga0466963_0022360 Ga0466963_0022360_164_637 157
31 3300044842 Ga0466957_0010176 Ga0466957_0010176_3040_3513 157
32 3300044842 Ga0466957_0261681 Ga0466957_0261681_80_553 157
33 3300045836 Ga0466958_0116195 Ga0466958_0116195_966_1439 157
34 3300046459 Ga0495629_0040778 Ga0495629_0040778_2700_3173 157
35 3300046461 Ga0495641_0007588 Ga0495641_0007588_2115_2588 157
36 3300005834 Ga0068851_10020464 Ga0068851_100204642 158
37 3300009101 Ga0105247_10017523 Ga0105247_100175232 158
38 3300014326 Ga0157380_10000037 Ga0157380_100000378 158
39 3300025321 Ga0207656_10013047 Ga0207656_100130473 158
40 3300025900 Ga0207710_10037460 Ga0207710_100374602 158
41 3300046461 Ga0495641_0210120 Ga0495641_0210120_288_764 158
42 3300046507 Ga0495606_0000072 Ga0495606_0000072_63764_64240 158
43 3300046529 Ga0495652_0009453 Ga0495652_0009453_866_1342 158
44 3300046543 Ga0495645_0009915 Ga0495645_0009915_109_585 158
45 3300046678 Ga0495599_0304782 Ga0495599_0304782_45_521 158
46 3300046690 Ga0495624_0257863 Ga0495624_0257863_25_501 158
47 3300048913 Ga0496110_0000021 Ga0496110_0000021_76569_77045 158
48 3300048914 Ga0496111_0000009 Ga0496111_0000009_56_532 158
49 3300053077 Ga0495601_0207477 Ga0495601_0207477_121_597 158
50 3300053078 Ga0495612_0155124 Ga0495612_0155124_107_583 158
51 3300005366 Ga0070659_100018092 Ga0070659_1000180924 159
52 3300005436 Ga0070713_100195925 Ga0070713_1001959252 159
53 3300009098 Ga0105245_10005833 Ga0105245_100058337 159
54 3300025927 Ga0207687_10002930 Ga0207687_100029307 159
55 3300025928 Ga0207700_10000027 Ga0207700_100000272 159
56 3300025932 Ga0207690_10008396 Ga0207690_100083963 159
57 3300028379 Ga0268266_10031179 Ga0268266_100311793 159
58 3300031731 Ga0307405_10680778 Ga0307405_106807782 159
59 3300032126 Ga0307415_100008149 Ga0307415_1000081498 159
60 3300044842 Ga0466957_0947970 Ga0466957_0947970_83_562 159
61 3300046689 Ga0495613_0000197 Ga0495613_0000197_47655_48134 159
62 3300047317 Ga0495604_0000155 Ga0495604_0000155_3057_3536 159
63 3300047317 Ga0495604_0018565 Ga0495604_0018565_2233_2712 159
64 3300048088 Ga0495602_0000070 Ga0495602_0000070_40785_41264 159
65 3300048907 Ga0496104_0313947 Ga0496104_0313947_110_589 159
66 3300053084 Ga0495595_0007967 Ga0495595_0007967_1273_1752 159
67 3300005436 Ga0070713_100058651 Ga0070713_1000586512 160
68 3300005436 Ga0070713_100240166 Ga0070713_1002401662 160
69 3300005437 Ga0070710_10310438 Ga0070710_103104382 160
70 3300005549 Ga0070704_101656450 Ga0070704_1016564501 160
71 3300005578 Ga0068854_100000090 Ga0068854_10000009027 160
72 3300005834 Ga0068851_10005809 Ga0068851_100058095 160
73 3300005840 Ga0068870_10098979 Ga0068870_100989792 160
74 3300010375 Ga0105239_10054313 Ga0105239_100543131 160
75 3300013105 Ga0157369_11772755 Ga0157369_117727551 160
76 3300013307 Ga0157372_10000253 Ga0157372_1000025312 160
77 3300025321 Ga0207656_10003166 Ga0207656_100031661 160
78 3300025916 Ga0207663_10181701 Ga0207663_101817012 160
79 3300025928 Ga0207700_10024883 Ga0207700_100248832 160
80 3300025928 Ga0207700_10098501 Ga0207700_100985012 160
81 3300025944 Ga0207661_10160746 Ga0207661_101607462 160
82 3300025981 Ga0207640_10000178 Ga0207640_1000017839 160
83 3300046511 Ga0495608_0000060 Ga0495608_0000060_33781_34263 160
84 3300046675 Ga0495657_0000004 Ga0495657_0000004_212057_212539 160
85 3300047444 Ga0495675_0000040 Ga0495675_0000040_31877_32359 160
86 3300048915 Ga0496112_0000153 Ga0496112_0000153_42519_43001 160
87 3300048916 Ga0496113_0000004 Ga0496113_0000004_108782_109264 160
88 3300053084 Ga0495595_0000003 Ga0495595_0000003_212057_212539 160
89 3300053085 Ga0495619_0000137 Ga0495619_0000137_72_554 160
90 3300005539 Ga0068853_100373294 Ga0068853_1003732942 161
91 3300005617 Ga0068859_101662928 Ga0068859_1016629281 161
92 3300005841 Ga0068863_100026388 Ga0068863_1000263882 161
93 3300006931 Ga0097620_101663063 Ga0097620_1016630632 161
94 3300013104 Ga0157370_10186575 Ga0157370_101865753 161
95 3300026041 Ga0207639_10170460 Ga0207639_101704602 161
96 3300026088 Ga0207641_10036321 Ga0207641_100363215 161
97 3300041486 Ga0451807_1617527 Ga0451807_1617527_262_747 161
98 3300046454 Ga0495592_0095211 Ga0495592_0095211_319_804 161
99 3300046678 Ga0495599_0125525 Ga0495599_0125525_212_697 161
100 3300047472 Ga0495686_0071200 Ga0495686_0071200_1352_1837 161
101 3300047673 Ga0495593_0496972 Ga0495593_0496972_102_593 163
102 3300005335 Ga0070666_10005262 Ga0070666_100052628 167
103 3300005344 Ga0070661_100000226 Ga0070661_10000022627 167
104 3300005365 Ga0070688_100001077 Ga0070688_1000010779 167
105 3300005367 Ga0070667_100103266 Ga0070667_1001032663 167
106 3300005435 Ga0070714_100521633 Ga0070714_1005216332 167
107 3300005456 Ga0070678_100021121 Ga0070678_1000211214 167
108 3300005466 Ga0070685_10001211 Ga0070685_100012119 167
109 3300005548 Ga0070665_100003494 Ga0070665_1000034949 167
110 3300005614 Ga0068856_100011706 Ga0068856_1000117065 167
111 3300005614 Ga0068856_100014337 Ga0068856_1000143375 167
112 3300009098 Ga0105245_10000662 Ga0105245_100006629 167
113 3300009177 Ga0105248_10000008 Ga0105248_10000008252 167
114 3300010375 Ga0105239_10255956 Ga0105239_102559562 167
115 3300013102 Ga0157371_10014976 Ga0157371_100149764 167
116 3300013105 Ga0157369_10000020 Ga0157369_10000020127 167
117 3300025903 Ga0207680_10014850 Ga0207680_100148503 167
118 3300025920 Ga0207649_10000009 Ga0207649_10000009151 167
119 3300025927 Ga0207687_10000007 Ga0207687_10000007492 167
120 3300025929 Ga0207664_10378854 Ga0207664_103788541 167
121 3300025941 Ga0207711_10000006 Ga0207711_10000006646 167
122 3300026041 Ga0207639_10027690 Ga0207639_100276904 167
123 3300026078 Ga0207702_10000158 Ga0207702_1000015823 167
124 3300026078 Ga0207702_10011880 Ga0207702_100118805 167
125 3300026121 Ga0207683_10010441 Ga0207683_100104412 167
126 3300028379 Ga0268266_10081695 Ga0268266_100816951 167
127 3300028379 Ga0268266_10513278 Ga0268266_105132782 167
128 3300046517 Ga0495630_0000020 Ga0495630_0000020_147779_148282 167
129 3300046683 Ga0495658_0000607 Ga0495658_0000607_6000_6503 167
130 3300048911 Ga0496108_0000146 Ga0496108_0000146_16750_17253 167
131 3300048912 Ga0496109_0000060 Ga0496109_0000060_115285_115788 167
132 3300005329 Ga0070683_100003110 Ga0070683_10000311010 168
133 3300005365 Ga0070688_100000938 Ga0070688_1000009389 168
134 3300005466 Ga0070685_10001120 Ga0070685_100011209 168
135 3300005535 Ga0070684_100072470 Ga0070684_1000724704 168
136 3300025944 Ga0207661_10000056 Ga0207661_100000566 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

2

150

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cfi-assembly4.cif.gz_D structural and functional attributes of malaria parasite ap4a hydrolase 0.7759 5 156
1vcd-assembly1.cif.gz_A crystal structure of a t.thermophilus hb8 ap6a hydrolase ndx1 0.7755 4 156
1ktg-assembly2.cif.gz_B crystal structure of a c. elegans ap4a hydrolase binary complex 0.7655 6 158
3h95-assembly1.cif.gz_A-2 crystal structure of the nudix domain of nudt6 0.7598 5 153
1vc9-assembly2.cif.gz_B crystal structure of a t.thermophilus hb8 ap6a hydrolase e50q mutant-mg2+-atp complex 0.7595 4 155
ID Description Score Start End Superfamily
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9478 4 152 3.90.79.10
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9293 4 152 3.90.79.10
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7835 6 155 3.90.79.10
5cfiD00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7759 5 156 3.90.79.10
af_A0A1D6LP98_107_156_1.10.10.1050 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Dcp2, box A domain 0.7686 6 60 1.10.10.1050
ID Description Score Start End GO Terms
AF-A0A1X9Z073-F1-model_v4 NUDIX hydrolase 0.9846 4 157 GO:0004081
GO:0006167
GO:0006754
AF-A0A520IGE4-F1-model_v4 NUDIX domain-containing protein 0.9833 5 157 GO:0004081
GO:0006167
GO:0006754
AF-A0A504L281-F1-model_v4 NUDIX domain-containing protein 0.9817 4 159 GO:0004081
GO:0006167
GO:0006754
GO:0020037
AF-A0A363TK43-F1-model_v4 NUDIX hydrolase 0.9803 3 157 GO:0004081
GO:0006167
GO:0006754
AF-A0A526RQ06-F1-model_v4 NUDIX domain-containing protein 0.9797 4 148 GO:0004081
GO:0006167
GO:0006754
GO:0020037

Feature Viewer

pLDDT pTM Quality
89.42 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map