F167976

General Info

Members Datasets Scaffolds Average Seq Length
136 93 273 121

Family's Representative Sequence

Representative Sequence 3300049704|Ga0501221_071170|Ga0501221_071170_23_433
Length 136
Sequence MLYEPYYFSGSMFTPMHNDPELSGKYLGTISQDFVKVSDILKEASYQIRKAGFEFPIFPISKESQPVGQLLIDKGSQETQWFYYASFLDEFVQRELVAPDRLEDFEKAFKNPDEFCCLFVVDQAFTNFVFIPFPED

Samples

Sample ID Description Type Environment
1 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
44 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
45 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
46 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
47 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
48 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
52 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
53 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
54 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
55 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
56 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
57 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
58 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
59 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
60 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
68 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
69 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
70 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
71 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
72 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
73 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
74 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
75 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
76 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
77 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
78 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
79 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
80 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
81 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
82 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
83 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
84 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
85 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
86 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
87 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
88 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
89 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
90 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
91 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
92 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
93 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.97
Nodule 0
Rhizoplane 0
Rhizosphere 61.03
Stem 0
Stem Tuber 0
Unclassified 18.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501221_071170 3300049704 Bacteria 821
2 rootH1_10001276 3300003316 Bacteria 3262
3 rootH1_10001276 3300003323 Bacteria 38627
4 rootH1_10001870 3300003316 Bacteria 68851
5 rootH1_10163358 3300003316 Bacteria 2671
6 rootH2_10016298 3300003320 Bacteria 24504
7 rootH2_10050649 3300003320 Bacteria 2315
8 rootH2_10219214 3300003320 Bacteria 3967
9 rootH2_10289408 3300003320 Bacteria 1935
10 rootL2_10000079 3300003322 Unclassified 4145
11 rootL2_10005963 3300003322 Bacteria 16733
12 rootL2_10048078 3300003322 Bacteria 2289
13 rootL2_10101643 3300003322 Unclassified 1899
14 rootL2_10111127 3300003322 Bacteria 5967
15 rootL2_10259667 3300003322 Bacteria 1129
16 rootL2_10279219 3300003322 Bacteria 2953
17 rootH1_10000031 3300003323 Bacteria 35221
18 rootH1_10030115 3300003323 Bacteria 5384
19 rootH1_10030116 3300003323 Bacteria 4700
20 rootH1_10093910 3300003323 Bacteria 7474
21 rootH1_10108149 3300003323 Unclassified 2334
22 rootH1_10125818 3300003323 Bacteria 1413
23 rootH1_10178126 3300003323 Unclassified 4881
24 Ga0055530_10058644 3300003791 Bacteria 866
25 Ga0055531_10000212 3300003794 Bacteria 63711
26 Ga0065165_1020397 3300005262 Bacteria 2332
27 Ga0065715_10123583 3300005293 Bacteria 2174
28 Ga0068868_101761843 3300005338 Unclassified 585
29 Ga0070693_100595063 3300005547 Bacteria 798
30 Ga0068855_100186693 3300005563 Bacteria 2341
31 Ga0068857_101830254 3300005577 Unclassified 594
32 Ga0068856_100235978 3300005614 Bacteria 1844
33 Ga0068852_100497571 3300005616 Bacteria 1213
34 Ga0068864_100633570 3300005618 Bacteria 1040
35 Ga0068863_100385274 3300005841 Bacteria 1369
36 Ga0068863_100476169 3300005841 Bacteria 1227
37 Ga0068858_100536330 3300005842 Bacteria 1132
38 Ga0097621_100414966 3300006237 Bacteria 1207
39 Ga0068871_100188368 3300006358 Bacteria 1776
40 Ga0075428_100099557 3300006844 Bacteria 3170
41 Ga0075430_100106596 3300006846 Bacteria 2338
42 Ga0075431_101949281 3300006847 Unclassified 543
43 Ga0105240_11491387 3300009093 Bacteria 709
44 Ga0111539_10004241 3300009094 Bacteria 18790
45 Ga0114129_11821524 3300009147 Bacteria 740
46 Ga0105237_12218054 3300009545 Unclassified 559
47 Ga0157374_12422480 3300013296 Bacteria 552
48 Ga0157380_10099910 3300014326 Bacteria 2414
49 Ga0157380_10540083 3300014326 Bacteria 1141
50 Ga0157376_10752045 3300014969 Unclassified 984
51 Ga0157376_11596483 3300014969 Bacteria 686
52 Ga0209050_1016137 3300025298 Bacteria 3078
53 Ga0209050_1046047 3300025298 Bacteria 1150
54 Ga0209257_1000007 3300025304 Bacteria 1564415
55 Ga0207695_11075776 3300025913 Bacteria 684
56 Ga0207702_10201829 3300026078 Bacteria 1844
57 Ga0207641_10363175 3300026088 Bacteria 1383
58 Ga0207641_10703357 3300026088 Unclassified 995
59 Ga0207676_10690239 3300026095 Unclassified 988
60 Ga0207674_11521101 3300026116 Unclassified 638
61 Ga0209996_1057397 3300027395 Bacteria 595
62 Ga0307515_10003118 3300028794 Bacteria 35057
63 Ga0307513_10073168 3300031456 Bacteria 3569
64 Ga0307513_11081105 3300031456 Bacteria 514
65 Ga0307509_10007469 3300031507 Bacteria 14263
66 Ga0307509_10244303 3300031507 Bacteria 1585
67 Ga0307509_10271143 3300031507 Bacteria 1464
68 Ga0307408_100038055 3300031548 Unclassified 3392
69 Ga0307408_100129107 3300031548 Unclassified 1969
70 Ga0316576_10389302 3300031727 Bacteria 1034
71 Ga0307516_10086584 3300031730 Unclassified 2969
72 Ga0307405_11330965 3300031731 Bacteria 626
73 Ga0307406_10222483 3300031901 Bacteria 1404
74 Ga0307406_10396991 3300031901 Unclassified 1092
75 Ga0307406_11247293 3300031901 Bacteria 647
76 Ga0307407_10025902 3300031903 Bacteria 3099
77 Ga0307412_10345400 3300031911 Bacteria 1193
78 Ga0307409_100009459 3300031995 Bacteria 5989
79 Ga0307416_100001097 3300032002 Bacteria 14491
80 Ga0307416_101045737 3300032002 Bacteria 920
81 Ga0307416_102501884 3300032002 Bacteria 615
82 Ga0307414_10000153 3300032004 Bacteria 46402
83 Ga0307414_10046988 3300032004 Bacteria 2967
84 Ga0307411_11742819 3300032005 Unclassified 577
85 Ga0307415_102230373 3300032126 Bacteria 536
86 Ga0373933_0456511 3300035724 Unclassified 836
87 Ga0316582_0809457 3300036647 Bacteria 642
88 Ga0316584_0497127 3300036712 Bacteria 857
89 Ga0400483_085337 3300039062 Bacteria 1377
90 Ga0451837_1702166 3300041494 Bacteria 1082
91 Ga0451849_0894521 3300041505 Bacteria 563
92 Ga0451851_1250267 3300041507 Unclassified 510
93 Ga0451853_0273022 3300041512 Bacteria 713
94 Ga0450890_035308 3300042127 Bacteria 725
95 Ga0451577_0001672 3300042876 Bacteria 28652
96 Ga0451577_0130135 3300042876 Bacteria 2257
97 Ga0451577_0558116 3300042876 Unclassified 1040
98 Ga0453683_0020128 3300044673 Unclassified 4264
99 Ga0453684_0000721 3300044712 Bacteria 116843
100 Ga0453684_0001647 3300044712 Bacteria 60658
101 Ga0453684_0328182 3300044712 Bacteria 1731
102 Ga0451576_0005787 3300045051 Bacteria 15382
103 Ga0451576_0011535 3300045051 Bacteria 10026
104 Ga0451576_0226432 3300045051 Bacteria 1952
105 Ga0451576_0267250 3300045051 Bacteria 1788
106 Ga0451576_1261067 3300045051 Unclassified 771
107 Ga0495638_0000013 3300046460 Bacteria 430133
108 Ga0495632_0051487 3300046519 Bacteria 2027
109 Ga0501202_000677 3300049652 Bacteria 5065
110 Ga0501207_007354 3300049654 Bacteria 1569
111 Ga0501217_078644 3300049661 Bacteria 910
112 Ga0501217_194399 3300049661 Unclassified 629
113 Ga0501227_220404 3300049665 Bacteria 540
114 Ga0501235_026409 3300049669 Bacteria 1301
115 Ga0501236_002504 3300049670 Bacteria 2112
116 Ga0501247_001920 3300049677 Bacteria 2101
117 Ga0501221_240198 3300049704 Bacteria 517
118 Ga0501225_0250737 3300049705 Bacteria 582
119 Ga0501264_000531 3300049761 Bacteria 5590
120 Ga0501226_005158 3300049853 Bacteria 1497
121 nmdc:mga0qj67_250395_c1 3300050509 Bacteria 1437
122 nmdc:mga06r32_953418_c1 3300050510 Bacteria 812
123 Ga0500644_0152726 3300053088 Bacteria 927
124 Ga0500646_0271992 3300053090 Bacteria 601
125 Ga0500651_0316572 3300053093 Bacteria 892
126 Ga0500650_0181185 3300053098 Bacteria 965
127 Ga0500556_0042078 3300053104 Bacteria 1614
128 Ga0500562_025629 3300053108 Bacteria 1544
129 Ga0500655_075549 3300053133 Unclassified 689
130 Ga0500658_0423961 3300053134 Bacteria 608
131 Ga0500577_0210124 3300053142 Bacteria 841
132 Ga0500616_0000013 3300053153 Bacteria 674172
133 Ga0500616_0048689 3300053153 Bacteria 2246
134 Ga0500616_0210234 3300053153 Unclassified 856
135 Ga0500622_0001633 3300053156 Bacteria 17550
136 2884636288 2884634485 Bacteria 3928637
137 2919696054 2919692658 Bacteria 5943958
138 Ga0501221_071170
139 rootH1_10001276
140 rootH1_10001870
141 rootH1_10163358
142 rootH2_10016298
143 rootH2_10050649
144 rootH2_10219214
145 rootH2_10289408
146 rootL2_10000079
147 rootL2_10005963
148 rootL2_10048078
149 rootL2_10101643
150 rootL2_10111127
151 rootL2_10259667
152 rootL2_10279219
153 rootH1_10000031
154 rootH1_10030115
155 rootH1_10030116
156 rootH1_10093910
157 rootH1_10108149
158 rootH1_10125818
159 rootH1_10178126
160 Ga0055530_10058644
161 Ga0055531_10000212
162 Ga0065165_1020397
163 Ga0065715_10123583
164 Ga0068868_101761843
165 Ga0070693_100595063
166 Ga0068855_100186693
167 Ga0068857_101830254
168 Ga0068856_100235978
169 Ga0068852_100497571
170 Ga0068864_100633570
171 Ga0068863_100385274
172 Ga0068863_100476169
173 Ga0068858_100536330
174 Ga0097621_100414966
175 Ga0068871_100188368
176 Ga0075428_100099557
177 Ga0075430_100106596
178 Ga0075431_101949281
179 Ga0105240_11491387
180 Ga0111539_10004241
181 Ga0114129_11821524
182 Ga0105237_12218054
183 Ga0157374_12422480
184 Ga0157380_10099910
185 Ga0157380_10540083
186 Ga0157376_10752045
187 Ga0157376_11596483
188 Ga0209050_1016137
189 Ga0209050_1046047
190 Ga0209257_1000007
191 Ga0207695_11075776
192 Ga0207702_10201829
193 Ga0207641_10363175
194 Ga0207641_10703357
195 Ga0207676_10690239
196 Ga0207674_11521101
197 Ga0209996_1057397
198 Ga0307515_10003118
199 Ga0307513_10073168
200 Ga0307513_11081105
201 Ga0307509_10007469
202 Ga0307509_10244303
203 Ga0307509_10271143
204 Ga0307408_100038055
205 Ga0307408_100129107
206 Ga0316576_10389302
207 Ga0307516_10086584
208 Ga0307405_11330965
209 Ga0307406_10222483
210 Ga0307406_10396991
211 Ga0307406_11247293
212 Ga0307407_10025902
213 Ga0307412_10345400
214 Ga0307409_100009459
215 Ga0307416_100001097
216 Ga0307416_101045737
217 Ga0307416_102501884
218 Ga0307414_10000153
219 Ga0307414_10046988
220 Ga0307411_11742819
221 Ga0307415_102230373
222 Ga0373933_0456511
223 Ga0316582_0809457
224 Ga0316584_0497127
225 Ga0400483_085337
226 Ga0451837_1702166
227 Ga0451849_0894521
228 Ga0451851_1250267
229 Ga0451853_0273022
230 Ga0450890_035308
231 Ga0451577_0001672
232 Ga0451577_0130135
233 Ga0451577_0558116
234 Ga0453683_0020128
235 Ga0453684_0000721
236 Ga0453684_0001647
237 Ga0453684_0328182
238 Ga0451576_0005787
239 Ga0451576_0011535
240 Ga0451576_0226432
241 Ga0451576_0267250
242 Ga0451576_1261067
243 Ga0495638_0000013
244 Ga0495632_0051487
245 Ga0501202_000677
246 Ga0501207_007354
247 Ga0501217_078644
248 Ga0501217_194399
249 Ga0501227_220404
250 Ga0501235_026409
251 Ga0501236_002504
252 Ga0501247_001920
253 Ga0501221_240198
254 Ga0501225_0250737
255 Ga0501264_000531
256 Ga0501226_005158
257 nmdc:mga0qj67_250395_c1
258 nmdc:mga06r32_953418_c1
259 Ga0500644_0152726
260 Ga0500646_0271992
261 Ga0500651_0316572
262 Ga0500650_0181185
263 Ga0500556_0042078
264 Ga0500562_025629
265 Ga0500655_075549
266 Ga0500658_0423961
267 Ga0500577_0210124
268 Ga0500616_0000013
269 Ga0500616_0048689
270 Ga0500616_0210234
271 Ga0500622_0001633
272 2884636288
273 2919696054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h9a-assembly1.cif.gz_A crystal structure of chemically modified e. coli thrs catalytic domain 2 0.4828 14 60
4lqe-assembly1.cif.gz_A crystal structure of mepb 0.4764 91 118
1zh8-assembly1.cif.gz_B crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution 0.4525 18 45
3ovk-assembly1.cif.gz_D crystal structure of an xxa-pro aminopeptidase from streptococcus pyogenes 0.4269 12 44
4m4w-assembly1.cif.gz_K mechanistic implications for the bacterial primosome assembly of the structure of a helicase-helicase loader complex 0.4237 76 119
ID Description Score Start End Superfamily
af_Q2G2D3_87_153_2.30.30.180 Mainly Beta;Roll;SH3 type barrels.;Ribosome maturation factor RimP, C-terminal domain 0.6919 95 117 2.30.30.180
af_K7N372_779_874_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.6262 98 117 2.60.40.1180
1kp0B01 Alpha Beta;3-Layer(aba) Sandwich;Creatine Amidinohydrolase; Chain A, domain 1;Creatinase/prolidase N-terminal domain 0.5647 21 47 3.40.350.10
af_Q2FZS8_772_869_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.5126 76 120 1.10.8.60
af_A4I599_9_262_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.5115 20 72 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A3D4AGT0-F1-model_v4 Uncharacterized protein 0.9801 10 120 GO:0016020
AF-A0A6M1Q1R5-F1-model_v4 deleted 0.979 22 118
AF-A0A1R4L119-F1-model_v4 Uncharacterized protein 0.9771 13 119
AF-A0A1Q3Q1Z6-F1-model_v4 Uncharacterized protein 0.9762 8 120
AF-A0A7X8BXT8-F1-model_v4 Uncharacterized protein 0.9754 8 118

Map