F168260

General Info

Members Datasets Scaffolds Average Seq Length
136 113 272 343

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939660829|2939664204
Length 367
Sequence QTLVNQGTFPSPSFSARGPLSARLLALLRSAPDGDPGLLPLADEAIGRAAGLVHDDDIQLTLFVLYGLHYGSVVETDDAWEWHPSLIALRRHLEAAFEAELRRVVPMPELPEPTSTAVASALFALTSEDSGPGLSRFVASKANREQLAEFLVHRSIYTLKEADPHSWAIPRLTGRAKAALVEIQADEYGGGRPERMHAVIFAGTMRGLGLDDRYGIYVDHVPAVTLASLNMMSMFGLNRRLRGAIAGHLAAFEMTSSIPNGLYARGFRRNGFGEDVTWYFDEHVEADAVHEQIAGRDLAGSLAEDEPALLADILFGAAACLTVDGWASAHLLDAWTAGRSALRVPLAGEPGASGAPSAAGDAAASGA

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
17 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
18 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
23 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
24 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
26 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
29 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
30 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
31 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
32 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
35 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
36 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
37 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
40 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
41 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
42 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
43 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
44 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
52 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
53 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
54 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
55 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
56 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
57 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
58 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
59 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
60 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
61 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
62 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
63 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
64 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
65 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
66 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
67 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
70 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
71 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
72 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
73 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
74 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
86 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
89 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
90 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
91 2643221616 Leifsonia sp. Root227 Isolate Unclassified
92 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
93 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
94 2739367653 Kocuria sp. OV113 Isolate Unclassified
95 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
96 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
97 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
98 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
99 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
100 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
101 2857727296 Kocuria sp. R-72562 Isolate Unclassified
102 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
103 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
104 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
105 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
106 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
107 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
108 2928153084 Leifsonia sp. 563 Isolate Unclassified
109 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
110 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
111 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
112 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
113 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.35
Metatranscriptomes 0
Isolates 17.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 0
Rhizoplane 8.82
Rhizosphere 63.24
Stem 0
Stem Tuber 0.74
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1006032 3300000549 Bacteria 1519
2 JGI24740J21852_10043304 3300001979 Bacteria 1343
3 JGI24735J21928_10001550 3300002067 Bacteria 8136
4 JGI25154J39366_1003012 3300002738 Bacteria 3831
5 JGI25164J39214_1000373 3300002772 Bacteria 26703
6 JGI25165J46597_1000014 3300003214 Bacteria 390383
7 Ga0055539_1000014 3300003752 Bacteria 381086
8 Ga0055533_1000002 3300003756 Bacteria 1196393
9 Ga0055525_1000115 3300003759 Bacteria 121883
10 Ga0055541_1000859 3300003841 Bacteria 7409
11 Ga0065714_10004646 3300005288 Bacteria 4638
12 Ga0070676_10084423 3300005328 Bacteria 1933
13 Ga0070672_100134219 3300005543 Bacteria 2037
14 Ga0075364_10063662 3300006051 Bacteria 2421
15 Ga0157369_10038125 3300013105 Bacteria 5257
16 Ga0163162_10255946 3300013306 Bacteria 1883
17 Ga0157375_10271085 3300013308 Bacteria 1859
18 Ga0209566_100056 3300025225 Bacteria 209595
19 Ga0209674_100001 3300025226 Bacteria 4013750
20 Ga0209563_100001 3300025230 Bacteria 4013775
21 Ga0209563_100172 3300025230 Bacteria 45261
22 Ga0207427_100041 3300025231 Bacteria 263659
23 Ga0209437_100980 3300025233 Bacteria 10072
24 Ga0209646_1000013 3300025246 Bacteria 565830
25 Ga0209646_1000014 3300025246 Bacteria 550484
26 Ga0209677_100001 3300025253 Bacteria 4013787
27 Ga0209233_1000014 3300025261 Bacteria 996641
28 Ga0207647_10081023 3300025904 Bacteria 1945
29 Ga0207691_10176242 3300025940 Bacteria 1870
30 Ga0265327_10000062 3300031251 Bacteria 234320
31 Ga0307408_100014620 3300031548 Bacteria 5215
32 Ga0307408_100032391 3300031548 Bacteria 3644
33 Ga0307408_100216418 3300031548 Bacteria 1560
34 Ga0307405_10019699 3300031731 Bacteria 3754
35 Ga0307413_10121043 3300031824 Bacteria 1773
36 Ga0307410_10003122 3300031852 Bacteria 8226
37 Ga0307410_10072502 3300031852 Bacteria 2391
38 Ga0307410_10123495 3300031852 Bacteria 1892
39 Ga0307410_10327097 3300031852 Bacteria 1218
40 Ga0307406_10021879 3300031901 Bacteria 3788
41 Ga0307406_10055026 3300031901 Bacteria 2542
42 Ga0307406_10141394 3300031901 Bacteria 1704
43 Ga0307412_10013108 3300031911 Bacteria 4850
44 Ga0307412_10149138 3300031911 Bacteria 1723
45 Ga0307414_10186535 3300032004 Bacteria 1674
46 Ga0307411_10089760 3300032005 Bacteria 2142
47 Ga0307411_10136903 3300032005 Bacteria 1800
48 Ga0395899_0000864 3300037312 Bacteria 28841
49 Ga0395900_0329296 3300037418 Bacteria 1506
50 Ga0451793_0187380 3300041452 Bacteria 1830
51 Ga0439433_0007223 3300041999 Bacteria 2399
52 Ga0439449_0053182 3300042007 Bacteria 1497
53 Ga0450920_007315 3300042122 Bacteria 2000
54 Ga0466972_0009972 3300044658 Bacteria 4769
55 Ga0466965_0000006 3300044683 Bacteria 158069
56 Ga0466966_0064459 3300044684 Bacteria 2306
57 Ga0466961_0043615 3300044693 Bacteria 2872
58 Ga0466970_0004156 3300044765 Bacteria 7124
59 Ga0466970_0083497 3300044765 Bacteria 1728
60 Ga0466970_0181314 3300044765 Bacteria 1168
61 Ga0466957_0002857 3300044842 Bacteria 9349
62 Ga0466960_0119642 3300044901 Bacteria 1378
63 Ga0466959_0012502 3300045049 Bacteria 6136
64 Ga0466959_0042503 3300045049 Bacteria 3352
65 Ga0466958_0019000 3300045836 Bacteria 3996
66 Ga0495653_0012980 3300046463 Bacteria 6797
67 Ga0495662_0007832 3300046476 Bacteria 5259
68 Ga0495630_0079103 3300046517 Bacteria 2480
69 Ga0495665_0001325 3300046531 Bacteria 13203
70 Ga0495587_0007020 3300046536 Bacteria 7313
71 Ga0495588_0036332 3300046674 Bacteria 2499
72 Ga0495657_0077540 3300046675 Bacteria 2156
73 Ga0495623_0034144 3300046679 Bacteria 3263
74 Ga0495600_0060580 3300046809 Bacteria 2471
75 Ga0495581_0009589 3300047315 Bacteria 5599
76 Ga0495680_0121296 3300047322 Bacteria 1930
77 Ga0496100_0213950 3300048903 Bacteria 1411
78 Ga0496102_0086715 3300048905 Bacteria 2891
79 Ga0496103_0080777 3300048906 Bacteria 2044
80 Ga0496103_0121719 3300048906 Bacteria 1662
81 Ga0496104_0185271 3300048907 Bacteria 1992
82 Ga0496104_0305538 3300048907 Bacteria 1503
83 Ga0496107_0108729 3300048910 Bacteria 2036
84 Ga0496109_0353779 3300048912 Bacteria 1387
85 Ga0496111_0136857 3300048914 Bacteria 1814
86 Ga0496111_0166620 3300048914 Bacteria 1636
87 Ga0496113_0125037 3300048916 Bacteria 2013
88 Ga0496117_0016389 3300048920 Bacteria 6257
89 Ga0496118_0003736 3300048921 Bacteria 18837
90 Ga0496122_0008168 3300048925 Bacteria 11383
91 Ga0496125_0038555 3300048928 Bacteria 4132
92 Ga0496125_0115540 3300048928 Bacteria 1930
93 Ga0501031_0062525 3300049568 Bacteria 2426
94 Ga0501032_0007329 3300049569 Bacteria 8064
95 Ga0501033_0168209 3300049570 Bacteria 1575
96 Ga0501034_0050269 3300049571 Bacteria 4205
97 Ga0501034_0116988 3300049571 Bacteria 2653
98 Ga0501034_0169608 3300049571 Bacteria 2150
99 Ga0501034_0189126 3300049571 Bacteria 2021
100 Ga0501036_0177258 3300049572 Bacteria 1795
101 Ga0501037_0026001 3300049573 Bacteria 4324
102 Ga0501038_0088024 3300049574 Bacteria 2607
103 Ga0501042_0000895 3300049578 Bacteria 16665
104 Ga0501047_0230550 3300049581 Bacteria 1705
105 Ga0501047_0351760 3300049581 Bacteria 1310
106 Ga0501048_0029165 3300049582 Bacteria 4003
107 Ga0501067_0051865 3300049583 Bacteria 2273
108 Ga0501083_0014311 3300049744 Bacteria 5548
109 Ga0501044_0155462 3300049823 Bacteria 2267
110 Ga0501044_0218601 3300049823 Bacteria 1856
111 Ga0500559_0001010 3300053136 Bacteria 17331
112 Ga0501082_0022411 3300060353 Bacteria 5440
113 2939664204 2939660829 Bacteria 3784848
114 2644097694 2643221616 Bacteria 4066575
115 2644504120 2643221690 Bacteria 4654705
116 2691515737 2690315906 Bacteria 4517044
117 2739603693 2739367653 Bacteria 2780952
118 2747954539 2747842429 Bacteria 3914386
119 2808629824 2808606306 Bacteria 3608896
120 2808893117 2808606370 Bacteria 4942454
121 2817510190 2816332305 Bacteria 2697803
122 2844844141 2844841374 Bacteria 3917147
123 2857726567 2857723135 Bacteria 4217853
124 2857728150 2857727296 Bacteria 2745552
125 2862995619 2862993130 Bacteria 3860849
126 2884763864 2884763398 Bacteria 4091164
127 2884995627 2884994152 Bacteria 4492978
128 2919056078 2919055335 Bacteria 3875751
129 2919393586 2919391150 Bacteria 4884741
130 2919526093 2919523602 Bacteria 3788128
131 2928154219 2928153084 Bacteria 4020257
132 2939602047 2939598168 Bacteria 4687164
133 2945960461 2945956166 Bacteria 5110334
134 2946083885 2946080515 Bacteria 4310960
135 2953998387 2953998280 Bacteria 4812144
136 8004184402 8004182704 Bacteria 3391155
137 LJQas_1006032
138 JGI24740J21852_10043304
139 JGI24735J21928_10001550
140 JGI25154J39366_1003012
141 JGI25164J39214_1000373
142 JGI25165J46597_1000014
143 Ga0055539_1000014
144 Ga0055533_1000002
145 Ga0055525_1000115
146 Ga0055541_1000859
147 Ga0065714_10004646
148 Ga0070676_10084423
149 Ga0070672_100134219
150 Ga0075364_10063662
151 Ga0157369_10038125
152 Ga0163162_10255946
153 Ga0157375_10271085
154 Ga0209566_100056
155 Ga0209674_100001
156 Ga0209563_100001
157 Ga0209563_100172
158 Ga0207427_100041
159 Ga0209437_100980
160 Ga0209646_1000013
161 Ga0209646_1000014
162 Ga0209677_100001
163 Ga0209233_1000014
164 Ga0207647_10081023
165 Ga0207691_10176242
166 Ga0265327_10000062
167 Ga0307408_100014620
168 Ga0307408_100032391
169 Ga0307408_100216418
170 Ga0307405_10019699
171 Ga0307413_10121043
172 Ga0307410_10003122
173 Ga0307410_10072502
174 Ga0307410_10123495
175 Ga0307410_10327097
176 Ga0307406_10021879
177 Ga0307406_10055026
178 Ga0307406_10141394
179 Ga0307412_10013108
180 Ga0307412_10149138
181 Ga0307414_10186535
182 Ga0307411_10089760
183 Ga0307411_10136903
184 Ga0395899_0000864
185 Ga0395900_0329296
186 Ga0451793_0187380
187 Ga0439433_0007223
188 Ga0439449_0053182
189 Ga0450920_007315
190 Ga0466972_0009972
191 Ga0466965_0000006
192 Ga0466966_0064459
193 Ga0466961_0043615
194 Ga0466970_0004156
195 Ga0466970_0083497
196 Ga0466970_0181314
197 Ga0466957_0002857
198 Ga0466960_0119642
199 Ga0466959_0012502
200 Ga0466959_0042503
201 Ga0466958_0019000
202 Ga0495653_0012980
203 Ga0495662_0007832
204 Ga0495630_0079103
205 Ga0495665_0001325
206 Ga0495587_0007020
207 Ga0495588_0036332
208 Ga0495657_0077540
209 Ga0495623_0034144
210 Ga0495600_0060580
211 Ga0495581_0009589
212 Ga0495680_0121296
213 Ga0496100_0213950
214 Ga0496102_0086715
215 Ga0496103_0080777
216 Ga0496103_0121719
217 Ga0496104_0185271
218 Ga0496104_0305538
219 Ga0496107_0108729
220 Ga0496109_0353779
221 Ga0496111_0136857
222 Ga0496111_0166620
223 Ga0496113_0125037
224 Ga0496117_0016389
225 Ga0496118_0003736
226 Ga0496122_0008168
227 Ga0496125_0038555
228 Ga0496125_0115540
229 Ga0501031_0062525
230 Ga0501032_0007329
231 Ga0501033_0168209
232 Ga0501034_0050269
233 Ga0501034_0116988
234 Ga0501034_0169608
235 Ga0501034_0189126
236 Ga0501036_0177258
237 Ga0501037_0026001
238 Ga0501038_0088024
239 Ga0501042_0000895
240 Ga0501047_0230550
241 Ga0501047_0351760
242 Ga0501048_0029165
243 Ga0501067_0051865
244 Ga0501083_0014311
245 Ga0501044_0155462
246 Ga0501044_0218601
247 Ga0500559_0001010
248 Ga0501082_0022411
249 2939664204
250 2644097694
251 2644504120
252 2691515737
253 2739603693
254 2747954539
255 2808629824
256 2808893117
257 2817510190
258 2844844141
259 2857726567
260 2857728150
261 2862995619
262 2884763864
263 2884995627
264 2919056078
265 2919393586
266 2919526093
267 2928154219
268 2939602047
269 2945960461
270 2946083885
271 2953998387
272 8004184402

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14518

Haem_oxygenas_2

Iron-containing redox enzyme

148

325

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rcw-assembly2.cif.gz_C-2 crystal structure of ct610 from chlamydia trachomatis 0.8086 101 314
1rcw-assembly2.cif.gz_C-2 crystal structure of ct610 from chlamydia trachomatis 0.7949 101 314
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.77 50 316
6m9s-assembly2.cif.gz_C crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7611 50 316
6m9r-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.7611 50 316
ID Description Score Start End Superfamily
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8271 96 319 1.20.910.10
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8166 96 319 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7865 101 314 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7728 101 314 1.20.910.10
af_Q54PI1_1_203_1.20.910.10 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7305 122 306 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A1B1K6T9-F1-model_v4 Iron-containing redox enzyme family protein 0.992 148 328
AF-A0A7J9XX92-F1-model_v4 Iron-containing redox enzyme family protein 0.9912 120 299
AF-A0A6G2UQ11-F1-model_v4 Iron-containing redox enzyme family protein 0.9828 125 330
AF-A0A2S8MFG0-F1-model_v4 deleted 0.9826 138 330
AF-A0A7W0RHM3-F1-model_v4 Iron-containing redox enzyme family protein 0.9773 173 331

Map