F170267

General Info

Members Datasets Scaffolds Average Seq Length
137 110 274 575

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10112245|Ga0265338_101122452
Length 633
Sequence MSRKVIVLKFGSSVLHSREELPHAVHEIYRWIRRQYRVVAVVSAFAGETDRLLSTVADYRDACPEAIARVVATGEEVATAFLALELDRFGIPAQVLDPSQIRLIAETTSNDTEPVSADILAIENVFKLGRVAVIPGFVARDRLGRVALFGRGGSDLSALFLAKQLDARCRLIKDVDGIYDSDPATCYDAKRFDEINFSDALAIGGKIVQQKAITFGRKTGVPFEVAALGEDYATAVGSHRSVLATRSSSAAPLKVGLLGLGTVGLGVFQELAKHPDLFEVAGIAVRRPDLHTDHAPGSLLTRNCWDAIGDVDVVVELIGGTEPAGDLVKAALAAGKPVVTANKLLLAQDAQLGGHRSLRYSAAVGGAVPALEAVGALADDGRIVSLSGVLNGTCNYILDRLAAGCSWTQAIAEAQAHGFAEADPRADLSGSDTVCKLRLLARRAFPDFDAHTISATGIDAIDPEWVQSAARDGGCARLVGTAQLVDGRVHLDVKPTLVDSLHPFAQIRNEENCLLIDTGHSDSQQLWIGRGAGRWPTTAAVMADLFDLSRELRATSPEXXXASASCQGPTSVGPDTARLDEGFSPCTVEWSQGLKAGSPATPAARLKPCPDTNRSSELTADHWPLATAFGGAA

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
94 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
95 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
99 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
105 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
106 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
107 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
108 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
109 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
110 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.16
Metatranscriptomes 2.92
Isolates 2.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.57
Nodule 0.73
Rhizoplane 0.73
Rhizosphere 84.67
Stem 0
Stem Tuber 0
Unclassified 14.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10112245 3300028800 Bacteria 2192
2 Ga0006562J51391_1027214 3300003578 Bacteria 13070
3 Ga0006562J51391_1027215 3300003578 Bacteria 9330
4 Ga0055536_1000290 3300003781 Bacteria 37915
5 Ga0065704_10078894 3300005289 Bacteria 4300
6 Ga0065715_10095221 3300005293 Bacteria 4136
7 Ga0065707_10001402 3300005295 Bacteria 21742
8 Ga0068869_100013984 3300005334 Bacteria 5352
9 Ga0070660_100033755 3300005339 Unclassified 3860
10 Ga0070692_10014967 3300005345 Unclassified 3658
11 Ga0070669_100037386 3300005353 Bacteria 3521
12 Ga0070671_100033802 3300005355 Unclassified 4231
13 Ga0070714_100072117 3300005435 Bacteria 2989
14 Ga0070694_100000925 3300005444 Bacteria 16588
15 Ga0070694_100060660 3300005444 Unclassified 2580
16 Ga0070681_10060965 3300005458 Bacteria 3748
17 Ga0070681_10073991 3300005458 Unclassified 3368
18 Ga0068867_100022439 3300005459 Bacteria 4514
19 Ga0070706_100000211 3300005467 Bacteria 71647
20 Ga0070706_100001057 3300005467 Bacteria 29881
21 Ga0070706_100003157 3300005467 Bacteria 16282
22 Ga0070706_100079073 3300005467 Bacteria 3044
23 Ga0070707_100000109 3300005468 Bacteria 75892
24 Ga0070679_100099467 3300005530 Unclassified 2896
25 Ga0070697_100045168 3300005536 Unclassified 3570
26 Ga0070697_100130656 3300005536 Bacteria 2106
27 Ga0068853_100047390 3300005539 Unclassified 3688
28 Ga0070695_100036418 3300005545 Bacteria 3097
29 Ga0070696_100005723 3300005546 Bacteria 8297
30 Ga0070664_100010353 3300005564 Bacteria 7565
31 Ga0068857_100023261 3300005577 Bacteria 5453
32 Ga0070702_100060407 3300005615 Bacteria 2204
33 Ga0068859_100034137 3300005617 Bacteria 5107
34 Ga0068864_100019167 3300005618 Bacteria 5719
35 Ga0068861_100003126 3300005719 Bacteria 10939
36 Ga0068863_100053068 3300005841 Bacteria 3842
37 Ga0068863_100068643 3300005841 Bacteria 3353
38 Ga0068858_100012394 3300005842 Bacteria 8039
39 Ga0068860_100002252 3300005843 Bacteria 20291
40 Ga0068860_100058951 3300005843 Bacteria 3650
41 Ga0068862_100087936 3300005844 Unclassified 2703
42 Ga0068862_100135521 3300005844 Unclassified 2182
43 Ga0081539_10004415 3300005985 Bacteria 15570
44 Ga0097621_100002456 3300006237 Bacteria 12688
45 Ga0097621_100083824 3300006237 Bacteria 2657
46 Ga0068871_100001154 3300006358 Bacteria 17729
47 Ga0075430_100032720 3300006846 Bacteria 4413
48 Ga0075434_100041048 3300006871 Unclassified 4582
49 Ga0075429_100008855 3300006880 Bacteria 8748
50 Ga0097620_100034136 3300006931 Bacteria 5107
51 Ga0099826_10052890 3300006948 Bacteria 2708
52 Ga0111539_10000363 3300009094 Bacteria 55793
53 Ga0105247_10043850 3300009101 Bacteria 2741
54 Ga0114129_10020138 3300009147 Bacteria 9494
55 Ga0114129_10132582 3300009147 Bacteria 3421
56 Ga0105243_10018882 3300009148 Bacteria 5227
57 Ga0105248_10125256 3300009177 Bacteria 2898
58 Ga0105238_10006008 3300009551 Bacteria 12032
59 Ga0105238_10008897 3300009551 Bacteria 10050
60 Ga0157370_10013545 3300013104 Bacteria 8393
61 Ga0157369_10063034 3300013105 Bacteria 3994
62 Ga0157372_10029397 3300013307 Bacteria 6000
63 Ga0157372_10080496 3300013307 Unclassified 3685
64 Ga0157372_10245854 3300013307 Unclassified 2076
65 Ga0163163_10018858 3300014325 Bacteria 6471
66 Ga0163163_10069233 3300014325 Bacteria 3513
67 Ga0157380_10000562 3300014326 Bacteria 22814
68 Ga0157377_10054801 3300014745 Bacteria 2259
69 Ga0157379_10027281 3300014968 Bacteria 5084
70 Ga0213872_10004967 3300021361 Bacteria 6918
71 Ga0209676_1000182 3300025292 Bacteria 146373
72 Ga0209676_1001439 3300025292 Bacteria 22421
73 Ga0209050_1008311 3300025298 Bacteria 5580
74 Ga0209257_1000484 3300025304 Bacteria 72044
75 Ga0207647_10004707 3300025904 Bacteria 10104
76 Ga0207684_10000450 3300025910 Bacteria 54199
77 Ga0207684_10002921 3300025910 Bacteria 16940
78 Ga0207707_10033389 3300025912 Bacteria 4503
79 Ga0207707_10035679 3300025912 Unclassified 4348
80 Ga0207695_10028677 3300025913 Bacteria 6163
81 Ga0207657_10036795 3300025919 Unclassified 4379
82 Ga0207646_10000445 3300025922 Bacteria 55392
83 Ga0207694_10010492 3300025924 Bacteria 6988
84 Ga0207694_10038332 3300025924 Bacteria 3685
85 Ga0207650_10068775 3300025925 Bacteria 2660
86 Ga0207644_10025567 3300025931 Unclassified 4060
87 Ga0207689_10078600 3300025942 Unclassified 2711
88 Ga0207639_10036174 3300026041 Unclassified 3658
89 Ga0207641_10094350 3300026088 Bacteria 2624
90 Ga0207648_10014116 3300026089 Bacteria 7388
91 Ga0207648_10066665 3300026089 Unclassified 3139
92 Ga0207676_10023306 3300026095 Bacteria 4565
93 Ga0207674_10004142 3300026116 Bacteria 17543
94 Ga0207674_10068692 3300026116 Bacteria 3565
95 Ga0207675_100006652 3300026118 Bacteria 10936
96 Ga0207675_100020756 3300026118 Bacteria 6124
97 Ga0207428_10008219 3300027907 Bacteria 9436
98 Ga0268264_10044215 3300028381 Bacteria 3694
99 Ga0265760_10002016 3300031090 Bacteria 5976
100 Ga0265760_10006425 3300031090 Bacteria 3362
101 Ga0265340_10030758 3300031247 Bacteria 2689
102 Ga0265316_10084001 3300031344 Bacteria 2439
103 Ga0307509_10003159 3300031507 Bacteria 25515
104 Ga0265313_10022704 3300031595 Bacteria 3397
105 Ga0316575_10008681 3300031665 Bacteria 3706
106 Ga0307406_10000305 3300031901 Bacteria 28688
107 Ga0307412_10017368 3300031911 Bacteria 4306
108 Ga0307414_10015361 3300032004 Bacteria 4621
109 Ga0307414_10023101 3300032004 Bacteria 3936
110 Ga0395899_0000004 3300037312 Bacteria 874267
111 Ga0436365_0840146 3300039437 Bacteria 3459
112 Ga0436361_0148204 3300039447 Bacteria 7568
113 Ga0495638_0030396 3300046460 Bacteria 3478
114 Ga0495633_0000752 3300046558 Bacteria 29244
115 Ga0495625_0001867 3300046660 Bacteria 23949
116 Ga0495649_0000134 3300046694 Bacteria 64953
117 Ga0496102_0107261 3300048905 Bacteria 2601
118 Ga0496121_0103231 3300048924 Bacteria 2194
119 Ga0496122_0004127 3300048925 Bacteria 18367
120 Ga0496123_0001649 3300048926 Bacteria 29965
121 Ga0496125_0000174 3300048928 Bacteria 144548
122 Ga0501046_0080180 3300049580 Bacteria 2523
123 Ga0501249_003826 3300049679 Unclassified 3036
124 nmdc:mga05p37_9501_c1 3300050507 Bacteria 11512
125 nmdc:mga0qj67_38918_c1 3300050509 Bacteria 3732
126 nmdc:mga08y16_183996_c1 3300050511 Bacteria 2168
127 nmdc:mga08y16_2462_c1 3300050511 Bacteria 19005
128 nmdc:mga0n895_5175_c1 3300050512 Bacteria 10855
129 nmdc:mga0a205_2043_c1 3300050515 Bacteria 17631
130 Ga0500644_0001774 3300053088 Bacteria 5585
131 Ga0500588_0011662 3300053146 Bacteria 2158
132 Ga0500622_0003802 3300053156 Bacteria 9829
133 Ga0500622_0004236 3300053156 Bacteria 9132
134 2644353872 2643221663 Bacteria 3425771
135 2928973108 2928972540 Bacteria 3058286
136 2941488975 2941485952 Bacteria 3591484
137 2977242886 2977240413 Bacteria 3191065
138 Ga0265338_10112245
139 Ga0006562J51391_1027214
140 Ga0006562J51391_1027215
141 Ga0055536_1000290
142 Ga0065704_10078894
143 Ga0065715_10095221
144 Ga0065707_10001402
145 Ga0068869_100013984
146 Ga0070660_100033755
147 Ga0070692_10014967
148 Ga0070669_100037386
149 Ga0070671_100033802
150 Ga0070714_100072117
151 Ga0070694_100000925
152 Ga0070694_100060660
153 Ga0070681_10060965
154 Ga0070681_10073991
155 Ga0068867_100022439
156 Ga0070706_100000211
157 Ga0070706_100001057
158 Ga0070706_100003157
159 Ga0070706_100079073
160 Ga0070707_100000109
161 Ga0070679_100099467
162 Ga0070697_100045168
163 Ga0070697_100130656
164 Ga0068853_100047390
165 Ga0070695_100036418
166 Ga0070696_100005723
167 Ga0070664_100010353
168 Ga0068857_100023261
169 Ga0070702_100060407
170 Ga0068859_100034137
171 Ga0068864_100019167
172 Ga0068861_100003126
173 Ga0068863_100053068
174 Ga0068863_100068643
175 Ga0068858_100012394
176 Ga0068860_100002252
177 Ga0068860_100058951
178 Ga0068862_100087936
179 Ga0068862_100135521
180 Ga0081539_10004415
181 Ga0097621_100002456
182 Ga0097621_100083824
183 Ga0068871_100001154
184 Ga0075430_100032720
185 Ga0075434_100041048
186 Ga0075429_100008855
187 Ga0097620_100034136
188 Ga0099826_10052890
189 Ga0111539_10000363
190 Ga0105247_10043850
191 Ga0114129_10020138
192 Ga0114129_10132582
193 Ga0105243_10018882
194 Ga0105248_10125256
195 Ga0105238_10006008
196 Ga0105238_10008897
197 Ga0157370_10013545
198 Ga0157369_10063034
199 Ga0157372_10029397
200 Ga0157372_10080496
201 Ga0157372_10245854
202 Ga0163163_10018858
203 Ga0163163_10069233
204 Ga0157380_10000562
205 Ga0157377_10054801
206 Ga0157379_10027281
207 Ga0213872_10004967
208 Ga0209676_1000182
209 Ga0209676_1001439
210 Ga0209050_1008311
211 Ga0209257_1000484
212 Ga0207647_10004707
213 Ga0207684_10000450
214 Ga0207684_10002921
215 Ga0207707_10033389
216 Ga0207707_10035679
217 Ga0207695_10028677
218 Ga0207657_10036795
219 Ga0207646_10000445
220 Ga0207694_10010492
221 Ga0207694_10038332
222 Ga0207650_10068775
223 Ga0207644_10025567
224 Ga0207689_10078600
225 Ga0207639_10036174
226 Ga0207641_10094350
227 Ga0207648_10014116
228 Ga0207648_10066665
229 Ga0207676_10023306
230 Ga0207674_10004142
231 Ga0207674_10068692
232 Ga0207675_100006652
233 Ga0207675_100020756
234 Ga0207428_10008219
235 Ga0268264_10044215
236 Ga0265760_10002016
237 Ga0265760_10006425
238 Ga0265340_10030758
239 Ga0265316_10084001
240 Ga0307509_10003159
241 Ga0265313_10022704
242 Ga0316575_10008681
243 Ga0307406_10000305
244 Ga0307412_10017368
245 Ga0307414_10015361
246 Ga0307414_10023101
247 Ga0395899_0000004
248 Ga0436365_0840146
249 Ga0436361_0148204
250 Ga0495638_0030396
251 Ga0495633_0000752
252 Ga0495625_0001867
253 Ga0495649_0000134
254 Ga0496102_0107261
255 Ga0496121_0103231
256 Ga0496122_0004127
257 Ga0496123_0001649
258 Ga0496125_0000174
259 Ga0501046_0080180
260 Ga0501249_003826
261 nmdc:mga05p37_9501_c1
262 nmdc:mga0qj67_38918_c1
263 nmdc:mga08y16_183996_c1
264 nmdc:mga08y16_2462_c1
265 nmdc:mga0n895_5175_c1
266 nmdc:mga0a205_2043_c1
267 Ga0500644_0001774
268 Ga0500588_0011662
269 Ga0500622_0003802
270 Ga0500622_0004236
271 2644353872
272 2928973108
273 2941488975
274 2977242886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00742

Homoserine_dh

Homoserine dehydrogenase

369

546

0.94

PF00696

AA_kinase

Amino acid kinase family

4

230

0.92

PF03447

NAD_binding_3

Homoserine dehydrogenase, NAD binding domain

259

367

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yei-assembly2.cif.gz_E mechanistic insight into the regulation of pseudomonas aeruginosa aspartate kinase 0.9269 24 258
3ab4-assembly1.cif.gz_C crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine 0.906 24 260
3ab2-assembly3.cif.gz_K crystal structure of aspartate kinase from corynebacterium glutamicum in complex with threonine 0.8982 24 261
3ab4-assembly2.cif.gz_G crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine 0.8965 24 258
3ab4-assembly3.cif.gz_I crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine 0.8953 24 260
ID Description Score Start End Superfamily
5yeiE01 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9275 24 261 3.40.1160.10
af_Q2FYP1_2_256_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9239 23 261 3.40.1160.10
5yeiE01 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9093 24 261 3.40.1160.10
3ab4G01 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8885 24 261 3.40.1160.10
3ab4G01 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8803 24 261 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A539CZU9-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9922 28 187 GO:0004072
GO:0005829
GO:0009089
GO:0009090
AF-A0A539CZU9-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9681 28 187 GO:0004072
GO:0005829
GO:0009089
GO:0009090
AF-A0A354VGS1-F1-model_v4 deleted 0.9497 23 199
AF-A0A2D6BL04-F1-model_v4 Homoserine dehydrogenase (EC 1.1.1.3) 0.9485 21 545 GO:0004412
GO:0009086
GO:0009088
GO:0050661
AF-A0A7X9PPT2-F1-model_v4 Aspartokinase (EC 2.7.2.4) 0.9456 23 262 GO:0004072
GO:0005524
GO:0005829
GO:0009088
GO:0009089
GO:0009090

Map