F173249

General Info

Members Datasets Scaffolds Average Seq Length
138 101 276 253

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1026248|Ga0209758_10262483
Length 282
Sequence MSGRPGFRAEGEGFIYGRLILLHGNRELPMSKSCVECRNGEAFTIPFSMAFQPIIDLRTDTIFAHEALVRGPTGEGAGSVLSAVDAFNRYAFDQQCRVKAIELASSLFPKDDGVGLSINFMPNAVYEPRACIRLTLAAAMRTNFPIRNIIFEFTESEQLDTAHLYNILQTYRDMGFRTAIDDFGAGHAGLGLLADFQPDIAKLDMALIRGIDTDDARQKIVKHTVAMLDDLGVTPLCEGIETVAELQALQDLGINLVQGYLIAKPSFEALAVPKFDAFRQAA

Samples

Sample ID Description Type Environment
1 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
15 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
18 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
19 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
24 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
28 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
33 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
36 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
37 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
38 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
39 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
40 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
41 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
42 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
43 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
44 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
45 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
46 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
47 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
48 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
49 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
50 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
51 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
52 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
53 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
54 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
55 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
58 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
59 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
60 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
61 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
62 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
63 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
64 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
65 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
66 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
67 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
68 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
69 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
70 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
71 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
72 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
73 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
74 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
75 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
76 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
77 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
78 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
79 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
80 2643221568 Rhizobium sp. Root564 Isolate Unclassified
81 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
82 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
83 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
84 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
85 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
86 2643221718 Rhizobium sp. Root268 Isolate Unclassified
87 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
88 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
89 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
90 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
91 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
92 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
93 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
94 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
95 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
96 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
97 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
98 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
99 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
100 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
101 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.26
Metatranscriptomes 0
Isolates 21.74

Biome Distribution

Category Percentage (%)
Aerial Root 2.9
Bulb 0
Endosphere 32.61
Nodule 1.45
Rhizoplane 3.62
Rhizosphere 25.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209758_1026248 3300025297 Bacteria 2528
2 rootH1_10014007 3300003316 Bacteria 3121
3 rootH2_10190202 3300003320 Bacteria 4456
4 rootH1_10234477 3300003323 Bacteria 3316
5 Ga0055524_1000895 3300003775 Bacteria 19308
6 Ga0055528_1000083 3300003790 Bacteria 74840
7 Ga0055540_1000273 3300003792 Bacteria 46613
8 Ga0055540_1003643 3300003792 Bacteria 7336
9 Ga0055531_10000106 3300003794 Bacteria 91868
10 Ga0055531_10004263 3300003794 Bacteria 8787
11 Ga0065165_1011394 3300005262 Bacteria 3716
12 Ga0065165_1012704 3300005262 Bacteria 3409
13 Ga0070670_100002341 3300005331 Bacteria 15603
14 Ga0070670_100007113 3300005331 Bacteria 9475
15 Ga0070665_100425128 3300005548 Bacteria 1337
16 Ga0075365_10002688 3300006038 Bacteria 8847
17 Ga0075364_10000471 3300006051 Bacteria 20466
18 Ga0075370_10043579 3300006353 Bacteria 2536
19 Ga0075370_10152802 3300006353 Bacteria 1353
20 Ga0079104_1000373 3300006946 Bacteria 52808
21 Ga0105238_10107047 3300009551 Bacteria 2777
22 Ga0157373_10024385 3300013100 Bacteria 4382
23 Ga0157371_10388214 3300013102 Bacteria 1020
24 Ga0157369_10217962 3300013105 Bacteria 1998
25 Ga0157369_10229445 3300013105 Bacteria 1941
26 Ga0157369_10523626 3300013105 Bacteria 1226
27 Ga0163162_10152739 3300013306 Bacteria 2427
28 Ga0183363_1005 3300015690 Bacteria 403020
29 Ga0163161_10172159 3300017792 Bacteria 1656
30 Ga0209673_1000086 3300025273 Bacteria 210101
31 Ga0209676_1013682 3300025292 Bacteria 3104
32 Ga0209676_1017652 3300025292 Bacteria 2517
33 Ga0209676_1019449 3300025292 Bacteria 2336
34 Ga0209025_1000044 3300025294 Bacteria 349480
35 Ga0209025_1002833 3300025294 Bacteria 17434
36 Ga0209025_1064751 3300025294 Bacteria 1340
37 Ga0209564_1001360 3300025295 Bacteria 25720
38 Ga0209758_1000105 3300025297 Bacteria 221415
39 Ga0209256_1002202 3300025299 Bacteria 16700
40 Ga0209051_1000192 3300025303 Bacteria 108667
41 Ga0209051_1025148 3300025303 Bacteria 2430
42 Ga0209257_1000300 3300025304 Bacteria 108786
43 Ga0209257_1017946 3300025304 Bacteria 2753
44 Ga0207694_10073627 3300025924 Bacteria 2673
45 Ga0207650_10000745 3300025925 Bacteria 25118
46 Ga0207650_10044002 3300025925 Bacteria 3280
47 Ga0209281_1000108 3300027111 Bacteria 217582
48 Ga0268266_10375224 3300028379 Bacteria 1340
49 Ga0307515_10003836 3300028794 Bacteria 31431
50 Ga0265327_10001007 3300031251 Bacteria 40000
51 Ga0307513_10001789 3300031456 Bacteria 30534
52 Ga0395905_0000821 3300037471 Bacteria 40750
53 Ga0436364_0868450 3300037853 Bacteria 1666
54 Ga0436365_0474911 3300039437 Bacteria 1341
55 Ga0436365_1106758 3300039437 Bacteria 2085
56 Ga0495596_0009393 3300046500 Bacteria 4303
57 Ga0495610_0006558 3300046512 Bacteria 7966
58 Ga0495610_0017566 3300046512 Bacteria 4075
59 Ga0495610_0055461 3300046512 Bacteria 1910
60 Ga0495632_0069778 3300046519 Bacteria 1691
61 Ga0495648_0029152 3300046524 Bacteria 3667
62 Ga0495654_0181806 3300046530 Bacteria 910
63 Ga0495625_0172169 3300046660 Bacteria 1445
64 Ga0495626_0001016 3300048091 Bacteria 24136
65 Ga0496116_0000142 3300048919 Bacteria 150342
66 Ga0496117_0003151 3300048920 Bacteria 19665
67 Ga0496117_0016613 3300048920 Bacteria 6198
68 Ga0496117_0188273 3300048920 Bacteria 1179
69 Ga0496118_0070468 3300048921 Bacteria 2524
70 Ga0496121_0000115 3300048924 Bacteria 178411
71 Ga0496121_0139013 3300048924 Bacteria 1805
72 Ga0496122_0000107 3300048925 Bacteria 193163
73 Ga0496122_0002543 3300048925 Bacteria 25659
74 Ga0496122_0025859 3300048925 Bacteria 5082
75 Ga0496123_0000063 3300048926 Bacteria 216072
76 Ga0496123_0057466 3300048926 Bacteria 2532
77 Ga0496123_0135796 3300048926 Bacteria 1354
78 Ga0496124_0000072 3300048927 Bacteria 219914
79 Ga0496124_0000428 3300048927 Bacteria 75094
80 Ga0496124_0017563 3300048927 Bacteria 6739
81 Ga0496124_0130599 3300048927 Bacteria 1996
82 Ga0496124_0230545 3300048927 Bacteria 1385
83 Ga0496124_0237767 3300048927 Bacteria 1357
84 Ga0496126_0129314 3300048929 Bacteria 2184
85 Ga0496126_0177670 3300048929 Bacteria 1810
86 Ga0501033_0027179 3300049570 Bacteria 4303
87 Ga0501034_0645805 3300049571 Bacteria 960
88 Ga0501080_0091764 3300049742 Bacteria 2821
89 Ga0501241_000978 3300049758 Bacteria 6015
90 Ga0501035_0001059 3300049822 Bacteria 28829
91 nmdc:mga00v17_221_c1 3300050491 Bacteria 34258
92 nmdc:mga0yw44_1879_c1 3300050492 Bacteria 8643
93 nmdc:mga07m45_5252_c1 3300050496 Bacteria 6431
94 Ga0500643_002643 3300053087 Bacteria 9058
95 Ga0500643_030155 3300053087 Bacteria 1663
96 Ga0500556_0026622 3300053104 Bacteria 1923
97 Ga0500562_045402 3300053108 Bacteria 1171
98 Ga0500607_001183 3300053121 Bacteria 24020
99 Ga0500608_048061 3300053122 Bacteria 2050
100 Ga0500618_000478 3300053125 Bacteria 25756
101 Ga0500559_0001465 3300053136 Bacteria 13356
102 Ga0500559_0016583 3300053136 Bacteria 3112
103 Ga0500559_0221677 3300053136 Bacteria 892
104 Ga0500573_0000100 3300053140 Bacteria 37372
105 Ga0500573_0005135 3300053140 Bacteria 6983
106 Ga0500573_0014138 3300053140 Bacteria 4510
107 Ga0500604_0010547 3300053151 Bacteria 2474
108 Ga0500636_0000005 3300053177 Bacteria 197561
109 2511173675 2510917026 Bacteria 7046020
110 2561468039 2558860983 Bacteria 4133860
111 2566036585 2565956521 Bacteria 4468993
112 2574431072 2574179768 Bacteria 4907129
113 2599332402 2599185156 Bacteria 5403036
114 2600200784 2599185354 Bacteria 4398675
115 2600377203 2600254933 Bacteria 4750527
116 2600377252 2600254933 Bacteria 4750527
117 2643856789 2643221568 Bacteria 5187270
118 2644088017 2643221614 Bacteria 4260023
119 2644208460 2643221637 Bacteria 5345260
120 2644344096 2643221661 Bacteria 4267604
121 2644367374 2643221666 Bacteria 4265935
122 2644500890 2643221689 Bacteria 6042950
123 2644651712 2643221718 Bacteria 5345506
124 2738948211 2738541317 Bacteria 5340176
125 2753765183 2751185897 Bacteria 5322941
126 2842922670 2842922631 Bacteria 5824079
127 2894818023 2894817345 Bacteria 4892941
128 2913313125 2913308742 Bacteria 5350706
129 2919169224 2919166419 Bacteria 4952238
130 2919173506 2919171160 Bacteria 6499771
131 2928029806 2928027323 Bacteria 4382488
132 2978974599 2978969890 Bacteria 5400756
133 2984557594 2984555340 Bacteria 4247089
134 2984568041 2984564862 Bacteria 4339992
135 2984589921 2984587000 Bacteria 5263363
136 2993359088 2993356040 Bacteria 4247105
137 8018152094 8018150411 Bacteria 5549903
138 8054464085 8054460903 Bacteria 4872905
139 Ga0209758_1026248
140 rootH1_10014007
141 rootH2_10190202
142 rootH1_10234477
143 Ga0055524_1000895
144 Ga0055528_1000083
145 Ga0055540_1000273
146 Ga0055540_1003643
147 Ga0055531_10000106
148 Ga0055531_10004263
149 Ga0065165_1011394
150 Ga0065165_1012704
151 Ga0070670_100002341
152 Ga0070670_100007113
153 Ga0070665_100425128
154 Ga0075365_10002688
155 Ga0075364_10000471
156 Ga0075370_10043579
157 Ga0075370_10152802
158 Ga0079104_1000373
159 Ga0105238_10107047
160 Ga0157373_10024385
161 Ga0157371_10388214
162 Ga0157369_10217962
163 Ga0157369_10229445
164 Ga0157369_10523626
165 Ga0163162_10152739
166 Ga0183363_1005
167 Ga0163161_10172159
168 Ga0209673_1000086
169 Ga0209676_1013682
170 Ga0209676_1017652
171 Ga0209676_1019449
172 Ga0209025_1000044
173 Ga0209025_1002833
174 Ga0209025_1064751
175 Ga0209564_1001360
176 Ga0209758_1000105
177 Ga0209256_1002202
178 Ga0209051_1000192
179 Ga0209051_1025148
180 Ga0209257_1000300
181 Ga0209257_1017946
182 Ga0207694_10073627
183 Ga0207650_10000745
184 Ga0207650_10044002
185 Ga0209281_1000108
186 Ga0268266_10375224
187 Ga0307515_10003836
188 Ga0265327_10001007
189 Ga0307513_10001789
190 Ga0395905_0000821
191 Ga0436364_0868450
192 Ga0436365_0474911
193 Ga0436365_1106758
194 Ga0495596_0009393
195 Ga0495610_0006558
196 Ga0495610_0017566
197 Ga0495610_0055461
198 Ga0495632_0069778
199 Ga0495648_0029152
200 Ga0495654_0181806
201 Ga0495625_0172169
202 Ga0495626_0001016
203 Ga0496116_0000142
204 Ga0496117_0003151
205 Ga0496117_0016613
206 Ga0496117_0188273
207 Ga0496118_0070468
208 Ga0496121_0000115
209 Ga0496121_0139013
210 Ga0496122_0000107
211 Ga0496122_0002543
212 Ga0496122_0025859
213 Ga0496123_0000063
214 Ga0496123_0057466
215 Ga0496123_0135796
216 Ga0496124_0000072
217 Ga0496124_0000428
218 Ga0496124_0017563
219 Ga0496124_0130599
220 Ga0496124_0230545
221 Ga0496124_0237767
222 Ga0496126_0129314
223 Ga0496126_0177670
224 Ga0501033_0027179
225 Ga0501034_0645805
226 Ga0501080_0091764
227 Ga0501241_000978
228 Ga0501035_0001059
229 nmdc:mga00v17_221_c1
230 nmdc:mga0yw44_1879_c1
231 nmdc:mga07m45_5252_c1
232 Ga0500643_002643
233 Ga0500643_030155
234 Ga0500556_0026622
235 Ga0500562_045402
236 Ga0500607_001183
237 Ga0500608_048061
238 Ga0500618_000478
239 Ga0500559_0001465
240 Ga0500559_0016583
241 Ga0500559_0221677
242 Ga0500573_0000100
243 Ga0500573_0005135
244 Ga0500573_0014138
245 Ga0500604_0010547
246 Ga0500636_0000005
247 2511173675
248 2561468039
249 2566036585
250 2574431072
251 2599332402
252 2600200784
253 2600377203
254 2600377252
255 2643856789
256 2644088017
257 2644208460
258 2644344096
259 2644367374
260 2644500890
261 2644651712
262 2738948211
263 2753765183
264 2842922670
265 2894818023
266 2913313125
267 2919169224
268 2919173506
269 2928029806
270 2978974599
271 2984557594
272 2984568041
273 2984589921
274 2993359088
275 8018152094
276 8054464085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00563

EAL

EAL domain

44

265

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ifq-assembly1.cif.gz_A crystal structure of a standalone versatile eal protein from vibrio cholerae o395 - apo form 0.9544 13 245
3gg0-assembly1.cif.gz_B klebsiella pneumoniae blrp1 ph 9.0 manganese/cy-digmp complex 0.9343 17 244
3gg0-assembly1.cif.gz_A klebsiella pneumoniae blrp1 ph 9.0 manganese/cy-digmp complex 0.9333 14 239
6ifq-assembly1.cif.gz_A crystal structure of a standalone versatile eal protein from vibrio cholerae o395 - apo form 0.9271 13 245
3gfy-assembly1.cif.gz_B klebsiella pneumoniae blrp1 with fmn and cyclic digmp, no metal ions 0.9256 15 241
ID Description Score Start End Superfamily
3gg0B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.9343 17 244 3.20.20.450
af_P75990_172_403_3.20.20.450 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.9213 20 245 3.20.20.450
af_P9WM13_355_611_3.20.20.450 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.898 18 235 3.20.20.450
af_P32701_269_524_3.20.20.450 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.893 18 239 3.20.20.450
af_P75990_172_403_3.20.20.450 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.8907 20 245 3.20.20.450
ID Description Score Start End GO Terms
AF-A0A3M7LK96-F1-model_v4 deleted 0.9765 122 225
AF-A0A259C287-F1-model_v4 Diguanylate phosphodiesterase 0.9753 39 245 GO:0071111
AF-A0A1D3RP06-F1-model_v4 Diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(S) 0.9693 136 235 GO:0071111
AF-A0A6H2HDL1-F1-model_v4 Blue light-and temperature-regulated antirepressor BluF 0.9558 4 242 GO:0071111
AF-B7DP82-F1-model_v4 deleted 0.9546 106 231

Map