F173580

General Info

Members Datasets Scaffolds Average Seq Length
138 107 277 180

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10060636|Ga0307513_100606364
Length 202
Sequence MLHDSGNPLRLPACFPPRSAGASMQRSELEHLIRAAGSIANDAEIVVIGSQSILGQFPNAPSPLLVSAEADLFPLHHPELADLIDGSIGEGSPFHELYGYYAQGVGERTAVLPRGWRDRLVRIENPNTSGVAGLCLDVHDLAISKLVAGREKDLEFTRELARQGMTDSKTLFSRLKETEVPMETRKLIEARIRRSSTQAKKR

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
43 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
72 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
103 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
104 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
105 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
106 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
107 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 0
Rhizoplane 0
Rhizosphere 80.43
Stem 0
Stem Tuber 0
Unclassified 23.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10060636 3300031456 Bacteria 4010
2 JGI25156J39149_1036081 3300002705 Bacteria 707
3 rootH1_10013386 3300003316 Bacteria 3606
4 rootH1_10013386 3300003323 Bacteria 42758
5 rootH2_10031844 3300003320 Bacteria 6474
6 rootL2_10006362 3300003322 Bacteria 20083
7 rootH1_10014338 3300003323 Bacteria 3725
8 Ga0055526_1005718 3300003771 Bacteria 7036
9 Ga0070683_100059157 3300005329 Bacteria 3560
10 Ga0070683_100638429 3300005329 Unclassified 1019
11 Ga0068869_100182310 3300005334 Bacteria 1647
12 Ga0070675_100197308 3300005354 Unclassified 1746
13 Ga0070713_100978136 3300005436 Unclassified 816
14 Ga0070713_101429520 3300005436 Unclassified 671
15 Ga0070708_101116354 3300005445 Unclassified 738
16 Ga0070681_10132777 3300005458 Bacteria 2421
17 Ga0070679_100038065 3300005530 Bacteria 4781
18 Ga0070684_100357753 3300005535 Unclassified 1343
19 Ga0070684_100618633 3300005535 Unclassified 1007
20 Ga0070665_100052011 3300005548 Bacteria 4109
21 Ga0070704_100120263 3300005549 Bacteria 2016
22 Ga0070704_100637946 3300005549 Bacteria 939
23 Ga0068855_100018557 3300005563 Bacteria 8364
24 Ga0068859_101011923 3300005617 Bacteria 913
25 Ga0068861_100002234 3300005719 Bacteria 12565
26 Ga0068863_100850108 3300005841 Unclassified 911
27 Ga0068858_100230143 3300005842 Unclassified 1757
28 Ga0097621_100478213 3300006237 Bacteria 1126
29 Ga0075370_10002068 3300006353 Bacteria 9134
30 Ga0075436_100214131 3300006914 Unclassified 1366
31 Ga0097620_101011990 3300006931 Bacteria 913
32 Ga0105240_10009540 3300009093 Bacteria 13741
33 Ga0105240_10017867 3300009093 Bacteria 9541
34 Ga0105240_10024152 3300009093 Bacteria 8021
35 Ga0105240_10048192 3300009093 Bacteria 5387
36 Ga0111539_10675640 3300009094 Bacteria 1202
37 Ga0105245_10516619 3300009098 Bacteria 1212
38 Ga0105248_10642880 3300009177 Unclassified 1197
39 Ga0105248_10692583 3300009177 Unclassified 1150
40 Ga0105248_10851081 3300009177 Bacteria 1029
41 Ga0105237_10060105 3300009545 Bacteria 3802
42 Ga0105237_10080235 3300009545 Bacteria 3253
43 Ga0105237_10284190 3300009545 Unclassified 1657
44 Ga0105237_10610406 3300009545 Unclassified 1098
45 Ga0105238_10121636 3300009551 Bacteria 2590
46 Ga0105238_10141715 3300009551 Bacteria 2380
47 Ga0105239_10522901 3300010375 Bacteria 1350
48 Ga0157370_10186628 3300013104 Unclassified 1925
49 Ga0157369_10012313 3300013105 Bacteria 9715
50 Ga0157369_10093374 3300013105 Bacteria 3212
51 Ga0157374_10231077 3300013296 Bacteria 1817
52 Ga0157372_10010703 3300013307 Bacteria 9761
53 Ga0157372_10036716 3300013307 Bacteria 5402
54 Ga0157372_10100187 3300013307 Bacteria 3306
55 Ga0157375_10092925 3300013308 Bacteria 3081
56 Ga0157380_10010017 3300014326 Bacteria 6804
57 Ga0157376_10067426 3300014969 Unclassified 3027
58 Ga0213876_10072099 3300021384 Bacteria 1824
59 Ga0209759_1002958 3300025256 Bacteria 7091
60 Ga0209564_1000120 3300025295 Bacteria 204226
61 Ga0207707_10028131 3300025912 Bacteria 4914
62 Ga0207695_10015025 3300025913 Bacteria 9135
63 Ga0207695_10025255 3300025913 Bacteria 6656
64 Ga0207695_10078384 3300025913 Bacteria 3352
65 Ga0207695_10228298 3300025913 Bacteria 1767
66 Ga0207671_10038412 3300025914 Bacteria 3548
67 Ga0207671_10127525 3300025914 Bacteria 1951
68 Ga0207671_10434046 3300025914 Unclassified 1045
69 Ga0207652_10179616 3300025921 Unclassified 1901
70 Ga0207694_11101992 3300025924 Unclassified 672
71 Ga0207700_10511994 3300025928 Unclassified 1063
72 Ga0207700_10674105 3300025928 Unclassified 922
73 Ga0207689_10084302 3300025942 Bacteria 2612
74 Ga0207661_10310089 3300025944 Unclassified 1416
75 Ga0207667_10005473 3300025949 Bacteria 15481
76 Ga0207667_10025338 3300025949 Bacteria 6494
77 Ga0207641_10813153 3300026088 Unclassified 925
78 Ga0207675_100005197 3300026118 Bacteria 12534
79 Ga0207698_10077874 3300026142 Bacteria 2660
80 Ga0268266_10036972 3300028379 Bacteria 4160
81 Ga0265326_10005635 3300028558 Bacteria 3940
82 Ga0265334_10017082 3300028573 Bacteria 3002
83 Ga0265318_10021903 3300028577 Bacteria 2561
84 Ga0265322_10091558 3300028654 Bacteria 864
85 Ga0307515_10002885 3300028794 Bacteria 36551
86 Ga0307515_10019148 3300028794 Bacteria 12340
87 Ga0307515_10115778 3300028794 Bacteria 3084
88 Ga0307512_10118049 3300030522 Bacteria 1717
89 Ga0265332_10058295 3300031238 Bacteria 1653
90 Ga0265328_10013765 3300031239 Bacteria 3195
91 Ga0265325_10007900 3300031241 Bacteria 6329
92 Ga0265329_10000582 3300031242 Bacteria 18881
93 Ga0265340_10248904 3300031247 Unclassified 792
94 Ga0265331_10033878 3300031250 Bacteria 2522
95 Ga0307513_10252152 3300031456 Bacteria 1561
96 Ga0307509_10002316 3300031507 Bacteria 31047
97 Ga0307408_100355210 3300031548 Bacteria 1245
98 Ga0307514_10079906 3300031649 Bacteria 2422
99 Ga0316575_10155162 3300031665 Bacteria 945
100 Ga0265314_10000170 3300031711 Bacteria 96635
101 Ga0307516_10681879 3300031730 Bacteria 684
102 Ga0307510_10070273 3300033180 Bacteria 3498
103 Ga0373956_0136117 3300035119 Bacteria 1152
104 Ga0373937_0151223 3300036401 Bacteria 2174
105 Ga0436365_1393355 3300039437 Bacteria 4184
106 Ga0436363_0751995 3300039450 Bacteria 1027
107 Ga0451577_0578363 3300042876 Bacteria 1020
108 Ga0466969_0007781 3300044656 Bacteria 5695
109 Ga0466969_0051869 3300044656 Unclassified 2017
110 Ga0466972_0111789 3300044658 Bacteria 1291
111 Ga0466966_0009119 3300044684 Bacteria 6570
112 Ga0466966_0060538 3300044684 Unclassified 2390
113 Ga0466961_0015412 3300044693 Bacteria 4907
114 Ga0466964_0429194 3300044706 Unclassified 696
115 Ga0453684_0699451 3300044712 Bacteria 1102
116 Ga0466971_0110073 3300044719 Unclassified 1270
117 Ga0466970_0003984 3300044765 Bacteria 7246
118 Ga0466959_0013682 3300045049 Bacteria 5888
119 Ga0466959_0204560 3300045049 Bacteria 1373
120 Ga0451576_0320034 3300045051 Bacteria 1623
121 Ga0495638_0068503 3300046460 Bacteria 2176
122 Ga0495638_0146160 3300046460 Bacteria 1375
123 Ga0501032_0017392 3300049569 Bacteria 5050
124 Ga0501033_0024501 3300049570 Unclassified 4552
125 Ga0501047_0178032 3300049581 Bacteria 1994
126 Ga0501076_0503498 3300049592 Bacteria 998
127 Ga0501076_0872475 3300049592 Bacteria 742
128 Ga0501227_000088 3300049665 Bacteria 14819
129 Ga0501044_0000107 3300049823 Bacteria 101613
130 nmdc:mga07m45_10977_c1 3300050496 Bacteria 4747
131 nmdc:mga0qj67_586079_c1 3300050509 Unclassified 893
132 nmdc:mga06r32_471525_c1 3300050510 Unclassified 1234
133 nmdc:mga08y16_455943_c1 3300050511 Bacteria 1303
134 Ga0500641_0098305 3300053096 Bacteria 1254
135 Ga0500588_0005509 3300053146 Unclassified 2816
136 Ga0500616_0013131 3300053153 Bacteria 4821
137 Ga0500637_0106092 3300053178 Bacteria 1629
138 Ga0466962_0008788 3300061719 Bacteria 4842
139 2886853419 2886848708 Bacteria 5632523
140 Ga0307513_10060636
141 JGI25156J39149_1036081
142 rootH1_10013386
143 rootH2_10031844
144 rootL2_10006362
145 rootH1_10014338
146 Ga0055526_1005718
147 Ga0070683_100059157
148 Ga0070683_100638429
149 Ga0068869_100182310
150 Ga0070675_100197308
151 Ga0070713_100978136
152 Ga0070713_101429520
153 Ga0070708_101116354
154 Ga0070681_10132777
155 Ga0070679_100038065
156 Ga0070684_100357753
157 Ga0070684_100618633
158 Ga0070665_100052011
159 Ga0070704_100120263
160 Ga0070704_100637946
161 Ga0068855_100018557
162 Ga0068859_101011923
163 Ga0068861_100002234
164 Ga0068863_100850108
165 Ga0068858_100230143
166 Ga0097621_100478213
167 Ga0075370_10002068
168 Ga0075436_100214131
169 Ga0097620_101011990
170 Ga0105240_10009540
171 Ga0105240_10017867
172 Ga0105240_10024152
173 Ga0105240_10048192
174 Ga0111539_10675640
175 Ga0105245_10516619
176 Ga0105248_10642880
177 Ga0105248_10692583
178 Ga0105248_10851081
179 Ga0105237_10060105
180 Ga0105237_10080235
181 Ga0105237_10284190
182 Ga0105237_10610406
183 Ga0105238_10121636
184 Ga0105238_10141715
185 Ga0105239_10522901
186 Ga0157370_10186628
187 Ga0157369_10012313
188 Ga0157369_10093374
189 Ga0157374_10231077
190 Ga0157372_10010703
191 Ga0157372_10036716
192 Ga0157372_10100187
193 Ga0157375_10092925
194 Ga0157380_10010017
195 Ga0157376_10067426
196 Ga0213876_10072099
197 Ga0209759_1002958
198 Ga0209564_1000120
199 Ga0207707_10028131
200 Ga0207695_10015025
201 Ga0207695_10025255
202 Ga0207695_10078384
203 Ga0207695_10228298
204 Ga0207671_10038412
205 Ga0207671_10127525
206 Ga0207671_10434046
207 Ga0207652_10179616
208 Ga0207694_11101992
209 Ga0207700_10511994
210 Ga0207700_10674105
211 Ga0207689_10084302
212 Ga0207661_10310089
213 Ga0207667_10005473
214 Ga0207667_10025338
215 Ga0207641_10813153
216 Ga0207675_100005197
217 Ga0207698_10077874
218 Ga0268266_10036972
219 Ga0265326_10005635
220 Ga0265334_10017082
221 Ga0265318_10021903
222 Ga0265322_10091558
223 Ga0307515_10002885
224 Ga0307515_10019148
225 Ga0307515_10115778
226 Ga0307512_10118049
227 Ga0265332_10058295
228 Ga0265328_10013765
229 Ga0265325_10007900
230 Ga0265329_10000582
231 Ga0265340_10248904
232 Ga0265331_10033878
233 Ga0307513_10252152
234 Ga0307509_10002316
235 Ga0307408_100355210
236 Ga0307514_10079906
237 Ga0316575_10155162
238 Ga0265314_10000170
239 Ga0307516_10681879
240 Ga0307510_10070273
241 Ga0373956_0136117
242 Ga0373937_0151223
243 Ga0436365_1393355
244 Ga0436363_0751995
245 Ga0451577_0578363
246 Ga0466969_0007781
247 Ga0466969_0051869
248 Ga0466972_0111789
249 Ga0466966_0009119
250 Ga0466966_0060538
251 Ga0466961_0015412
252 Ga0466964_0429194
253 Ga0453684_0699451
254 Ga0466971_0110073
255 Ga0466970_0003984
256 Ga0466959_0013682
257 Ga0466959_0204560
258 Ga0451576_0320034
259 Ga0495638_0068503
260 Ga0495638_0146160
261 Ga0501032_0017392
262 Ga0501033_0024501
263 Ga0501047_0178032
264 Ga0501076_0503498
265 Ga0501076_0872475
266 Ga0501227_000088
267 Ga0501044_0000107
268 nmdc:mga07m45_10977_c1
269 nmdc:mga0qj67_586079_c1
270 nmdc:mga06r32_471525_c1
271 nmdc:mga08y16_455943_c1
272 Ga0500641_0098305
273 Ga0500588_0005509
274 Ga0500616_0013131
275 Ga0500637_0106092
276 Ga0466962_0008788
277 2886853419

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19502

DUF6036

Nucleotidyltransferase of unknown function (DUF6036)

27

201

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n9g-assembly1.cif.gz_C crystal structure of a computationally designed rsv-presenting epitope scaffold and its elicited antibody 17hd9 0.896 145 178
2w69-assembly2.cif.gz_B influenza polymerase fragment 0.8938 157 182
2w69-assembly1.cif.gz_A influenza polymerase fragment 0.8835 157 182
4n9g-assembly1.cif.gz_C crystal structure of a computationally designed rsv-presenting epitope scaffold and its elicited antibody 17hd9 0.854 145 178
4n9g-assembly4.cif.gz_Z crystal structure of a computationally designed rsv-presenting epitope scaffold and its elicited antibody 17hd9 0.8117 146 178
ID Description Score Start End Superfamily
af_I6WZ83_1_185_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.9114 1 176 3.30.460.40
af_I6WZ83_1_185_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.8645 1 176 3.30.460.40
af_A0A0R0JH42_136_370_3.40.462.10 Alpha Beta;3-Layer(aba) Sandwich;Vanillyl-alcohol Oxidase; Chain A, domain 3;FAD-linked oxidases, C-terminal domain 0.8434 156 185 3.40.462.10
af_Q9VFS1_26_498_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7534 149 176 3.20.20.140
af_A0A1D6E9H4_7_153_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7083 144 178 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2U1DIC6-F1-model_v4 DUF6036 domain-containing protein 0.9957 1 173
AF-A0A853IX98-F1-model_v4 DUF6036 domain-containing protein 0.9838 1 173
AF-A0A1F7F371-F1-model_v4 DUF6036 domain-containing protein 0.9813 1 173
AF-A0A496WZ14-F1-model_v4 DUF6036 domain-containing protein 0.9811 1 173
AF-A0A1S8FWT0-F1-model_v4 deleted 0.9797 1 178

Map