F174673

General Info

Members Datasets Scaffolds Average Seq Length
138 110 276 222

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0124855|Ga0500568_0124855_81_857
Length 258
Sequence MPVFRLDKRLVFPPVELAEDGLLAVGGDLTPQRLLLGYSQGIFPWYGPKLPILWHSPDPRMVMETRDLIINRSLRKHLRKQPYELRIDTAFTEVLTRCSDVPRPGQDGTWLVPDMVDAYTKLHELGFAHSFEAWSGGELVGGLYGVSLGTCFFGESMFARAPDASKIAFAASVAQLDAWEIRLIDCQVHTDHLARLGATEISRPAFITRLKLALDAPTRRGRWAFEMDLAAWAARGGDWPDAPAAAAPATSTGDGSAE

Samples

Sample ID Description Type Environment
1 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
60 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
68 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
72 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
73 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
74 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
75 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
76 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
77 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
85 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
86 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
87 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
104 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
106 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
107 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
108 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
109 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
110 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.38
Metatranscriptomes 0
Isolates 3.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.35
Nodule 1.45
Rhizoplane 0
Rhizosphere 86.96
Stem 0
Stem Tuber 0
Unclassified 18.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500568_0124855 3300053139 Bacteria 958
2 rootH2_10053682 3300003320 Bacteria 6853
3 rootH2_10106789 3300003320 Bacteria 2264
4 rootH2_10116842 3300003320 Bacteria 2374
5 rootL2_10213117 3300003322 Unclassified 2636
6 Ga0055542_1004395 3300003762 Bacteria 3444
7 Ga0070683_100007856 3300005329 Bacteria 9035
8 Ga0068868_100588640 3300005338 Bacteria 984
9 Ga0070691_10063568 3300005341 Bacteria 1779
10 Ga0070694_100238910 3300005444 Bacteria 1370
11 Ga0068867_100198685 3300005459 Unclassified 1604
12 Ga0070707_100090721 3300005468 Bacteria 2958
13 Ga0070698_100001798 3300005471 Bacteria 23864
14 Ga0070684_100000851 3300005535 Bacteria 21510
15 Ga0068853_100031174 3300005539 Unclassified 4509
16 Ga0068853_100254023 3300005539 Unclassified 1614
17 Ga0070696_100079028 3300005546 Bacteria 2327
18 Ga0068855_100000420 3300005563 Bacteria 52301
19 Ga0068855_100012457 3300005563 Bacteria 10268
20 Ga0068856_100946163 3300005614 Bacteria 880
21 Ga0068859_100617349 3300005617 Bacteria 1177
22 Ga0068864_100187271 3300005618 Bacteria 1895
23 Ga0068866_10283977 3300005718 Bacteria 1027
24 Ga0068860_100256975 3300005843 Unclassified 1702
25 Ga0068860_101174365 3300005843 Unclassified 788
26 Ga0068862_100175735 3300005844 Unclassified 1920
27 Ga0081540_1024128 3300005983 Bacteria 3536
28 Ga0068871_100441277 3300006358 Bacteria 1165
29 Ga0075428_100068405 3300006844 Bacteria 3885
30 Ga0075431_100433776 3300006847 Bacteria 1312
31 Ga0097620_100617335 3300006931 Bacteria 1177
32 Ga0099826_10042882 3300006948 Bacteria 3121
33 Ga0105240_10000188 3300009093 Bacteria 126031
34 Ga0105240_10002800 3300009093 Bacteria 27570
35 Ga0105240_10010808 3300009093 Bacteria 12785
36 Ga0105240_10037831 3300009093 Bacteria 6197
37 Ga0105240_10274452 3300009093 Bacteria 1940
38 Ga0111539_10896900 3300009094 Bacteria 1031
39 Ga0105243_10227877 3300009148 Unclassified 1651
40 Ga0105238_10058172 3300009551 Unclassified 3875
41 Ga0105239_10000246 3300010375 Bacteria 80752
42 Ga0105239_10000675 3300010375 Bacteria 48613
43 Ga0105239_10111223 3300010375 Bacteria 3036
44 Ga0105239_10157376 3300010375 Bacteria 2538
45 Ga0157370_10306302 3300013104 Unclassified 1466
46 Ga0157374_10000002 3300013296 Bacteria 1054226
47 Ga0157378_10645468 3300013297 Unclassified 1074
48 Ga0157378_10785183 3300013297 Unclassified 977
49 Ga0157372_10019038 3300013307 Bacteria 7391
50 Ga0157380_10000244 3300014326 Bacteria 32717
51 Ga0157380_10066157 3300014326 Bacteria 2907
52 Ga0157376_10119576 3300014969 Bacteria 2333
53 Ga0213872_10022004 3300021361 Bacteria 2936
54 Ga0209258_100068 3300025242 Bacteria 286288
55 Ga0209148_1000343 3300025254 Bacteria 61260
56 Ga0207642_10090304 3300025899 Unclassified 1511
57 Ga0207647_10066107 3300025904 Bacteria 2193
58 Ga0207684_10066022 3300025910 Bacteria 3073
59 Ga0207695_10000016 3300025913 Bacteria 771991
60 Ga0207695_10000060 3300025913 Bacteria 360217
61 Ga0207695_10000284 3300025913 Bacteria 126041
62 Ga0207695_10064547 3300025913 Bacteria 3769
63 Ga0207695_10128094 3300025913 Bacteria 2498
64 Ga0207695_10418324 3300025913 Bacteria 1224
65 Ga0207646_10323264 3300025922 Bacteria 1394
66 Ga0207694_10041525 3300025924 Unclassified 3545
67 Ga0207659_10823170 3300025926 Bacteria 798
68 Ga0207689_10007831 3300025942 Bacteria 9338
69 Ga0207689_10057208 3300025942 Bacteria 3208
70 Ga0207661_10028123 3300025944 Bacteria 4302
71 Ga0207661_10500211 3300025944 Unclassified 1110
72 Ga0207667_10000241 3300025949 Bacteria 76753
73 Ga0207667_10007482 3300025949 Bacteria 13115
74 Ga0207639_10265314 3300026041 Unclassified 1504
75 Ga0207702_11065160 3300026078 Unclassified 802
76 Ga0207648_10037817 3300026089 Bacteria 4249
77 Ga0207676_10054117 3300026095 Bacteria 3144
78 Ga0207674_10194519 3300026116 Bacteria 1978
79 Ga0209282_1012181 3300027666 Bacteria 5467
80 Ga0268264_10450778 3300028381 Unclassified 1246
81 Ga0316177_1015668 3300030731 Unclassified 1476
82 Ga0265332_10003131 3300031238 Bacteria 8061
83 Ga0265339_10010310 3300031249 Bacteria 5811
84 Ga0265316_10009145 3300031344 Bacteria 9128
85 Ga0265314_10000003 3300031711 Bacteria 1653386
86 Ga0307416_100002787 3300032002 Bacteria 10148
87 Ga0307510_10001098 3300033180 Bacteria 28868
88 Ga0395905_0138738 3300037471 Bacteria 2288
89 Ga0400490_29571 3300038726 Bacteria 33032
90 Ga0400491_06162 3300038727 Bacteria 2926
91 Ga0436365_0955065 3300039437 Bacteria 1492
92 Ga0436365_0962331 3300039437 Bacteria 1458
93 Ga0436361_0185139 3300039447 Bacteria 11803
94 Ga0439465_0056027 3300041413 Bacteria 1299
95 Ga0439431_0131734 3300041997 Unclassified 702
96 Ga0439433_0049593 3300041999 Bacteria 988
97 Ga0439462_0039537 3300042015 Unclassified 1258
98 Ga0450894_011169 3300042131 Bacteria 1168
99 Ga0450898_020883 3300042134 Bacteria 1150
100 Ga0439434_0004914 3300042435 Bacteria 3909
101 Ga0451577_0003363 3300042876 Bacteria 17899
102 Ga0451577_0641774 3300042876 Bacteria 963
103 Ga0453683_0125453 3300044673 Bacteria 1616
104 Ga0453684_0011892 3300044712 Bacteria 14492
105 Ga0466970_0153984 3300044765 Bacteria 1270
106 Ga0451576_0000022 3300045051 Bacteria 495037
107 Ga0495606_0018209 3300046507 Bacteria 5277
108 Ga0495643_0054284 3300046522 Bacteria 2146
109 Ga0495611_0000115 3300046648 Bacteria 56623
110 Ga0495588_0104508 3300046674 Bacteria 1490
111 Ga0495687_010408 3300047443 Bacteria 5102
112 Ga0495686_0000195 3300047472 Bacteria 113003
113 Ga0495686_0044333 3300047472 Bacteria 2816
114 Ga0501033_0159455 3300049570 Unclassified 1624
115 Ga0501034_0035245 3300049571 Bacteria 5073
116 Ga0501034_0743311 3300049571 Bacteria 877
117 Ga0501036_0296999 3300049572 Bacteria 1351
118 Ga0501037_0140059 3300049573 Unclassified 1732
119 Ga0501043_0097813 3300049579 Bacteria 2307
120 Ga0501046_0533304 3300049580 Unclassified 838
121 Ga0501047_0488699 3300049581 Unclassified 1058
122 Ga0501067_0082769 3300049583 Bacteria 1780
123 Ga0501069_0031634 3300049585 Bacteria 2912
124 Ga0501070_0115361 3300049586 Bacteria 2218
125 Ga0501070_0158463 3300049586 Bacteria 1866
126 Ga0501083_0024993 3300049744 Bacteria 4137
127 Ga0501035_0179182 3300049822 Bacteria 1827
128 Ga0501044_0024837 3300049823 Bacteria 6357
129 Ga0501044_0078498 3300049823 Bacteria 3345
130 nmdc:mga05p37_308882_c1 3300050507 Bacteria 1875
131 Ga0500641_0030423 3300053096 Unclassified 2122
132 Ga0500607_009503 3300053121 Bacteria 5847
133 Ga0501082_0294371 3300060353 Bacteria 1413
134 2520881007 2519899754 Bacteria 5336938
135 2817414666 2816332280 Bacteria 5109718
136 2883071138 2883068021 Bacteria 6192739
137 2903895749 2903895155 Bacteria 5258610
138 2958462643 2958458903 Bacteria 5301041
139 Ga0500568_0124855
140 rootH2_10053682
141 rootH2_10106789
142 rootH2_10116842
143 rootL2_10213117
144 Ga0055542_1004395
145 Ga0070683_100007856
146 Ga0068868_100588640
147 Ga0070691_10063568
148 Ga0070694_100238910
149 Ga0068867_100198685
150 Ga0070707_100090721
151 Ga0070698_100001798
152 Ga0070684_100000851
153 Ga0068853_100031174
154 Ga0068853_100254023
155 Ga0070696_100079028
156 Ga0068855_100000420
157 Ga0068855_100012457
158 Ga0068856_100946163
159 Ga0068859_100617349
160 Ga0068864_100187271
161 Ga0068866_10283977
162 Ga0068860_100256975
163 Ga0068860_101174365
164 Ga0068862_100175735
165 Ga0081540_1024128
166 Ga0068871_100441277
167 Ga0075428_100068405
168 Ga0075431_100433776
169 Ga0097620_100617335
170 Ga0099826_10042882
171 Ga0105240_10000188
172 Ga0105240_10002800
173 Ga0105240_10010808
174 Ga0105240_10037831
175 Ga0105240_10274452
176 Ga0111539_10896900
177 Ga0105243_10227877
178 Ga0105238_10058172
179 Ga0105239_10000246
180 Ga0105239_10000675
181 Ga0105239_10111223
182 Ga0105239_10157376
183 Ga0157370_10306302
184 Ga0157374_10000002
185 Ga0157378_10645468
186 Ga0157378_10785183
187 Ga0157372_10019038
188 Ga0157380_10000244
189 Ga0157380_10066157
190 Ga0157376_10119576
191 Ga0213872_10022004
192 Ga0209258_100068
193 Ga0209148_1000343
194 Ga0207642_10090304
195 Ga0207647_10066107
196 Ga0207684_10066022
197 Ga0207695_10000016
198 Ga0207695_10000060
199 Ga0207695_10000284
200 Ga0207695_10064547
201 Ga0207695_10128094
202 Ga0207695_10418324
203 Ga0207646_10323264
204 Ga0207694_10041525
205 Ga0207659_10823170
206 Ga0207689_10007831
207 Ga0207689_10057208
208 Ga0207661_10028123
209 Ga0207661_10500211
210 Ga0207667_10000241
211 Ga0207667_10007482
212 Ga0207639_10265314
213 Ga0207702_11065160
214 Ga0207648_10037817
215 Ga0207676_10054117
216 Ga0207674_10194519
217 Ga0209282_1012181
218 Ga0268264_10450778
219 Ga0316177_1015668
220 Ga0265332_10003131
221 Ga0265339_10010310
222 Ga0265316_10009145
223 Ga0265314_10000003
224 Ga0307416_100002787
225 Ga0307510_10001098
226 Ga0395905_0138738
227 Ga0400490_29571
228 Ga0400491_06162
229 Ga0436365_0955065
230 Ga0436365_0962331
231 Ga0436361_0185139
232 Ga0439465_0056027
233 Ga0439431_0131734
234 Ga0439433_0049593
235 Ga0439462_0039537
236 Ga0450894_011169
237 Ga0450898_020883
238 Ga0439434_0004914
239 Ga0451577_0003363
240 Ga0451577_0641774
241 Ga0453683_0125453
242 Ga0453684_0011892
243 Ga0466970_0153984
244 Ga0451576_0000022
245 Ga0495606_0018209
246 Ga0495643_0054284
247 Ga0495611_0000115
248 Ga0495588_0104508
249 Ga0495687_010408
250 Ga0495686_0000195
251 Ga0495686_0044333
252 Ga0501033_0159455
253 Ga0501034_0035245
254 Ga0501034_0743311
255 Ga0501036_0296999
256 Ga0501037_0140059
257 Ga0501043_0097813
258 Ga0501046_0533304
259 Ga0501047_0488699
260 Ga0501067_0082769
261 Ga0501069_0031634
262 Ga0501070_0115361
263 Ga0501070_0158463
264 Ga0501083_0024993
265 Ga0501035_0179182
266 Ga0501044_0024837
267 Ga0501044_0078498
268 nmdc:mga05p37_308882_c1
269 Ga0500641_0030423
270 Ga0500607_009503
271 Ga0501082_0294371
272 2520881007
273 2817414666
274 2883071138
275 2903895749
276 2958462643

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03588

Leu_Phe_trans

Leucyl/phenylalanyl-tRNA protein transferase

31

202

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z3o-assembly1.cif.gz_A complex structure of lf-transferase and phenylalanine 0.9505 2 213
2cxa-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9463 1 213
2dps-assembly1.cif.gz_A structure of leucyl/phenylalanyl-trna-protein transferase 0.9408 3 213
2z3l-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9385 2 213
2z3n-assembly1.cif.gz_B complex structure of lf-transferase and peptide b 0.9354 2 213
ID Description Score Start End Superfamily
2z3kA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain 0.9551 58 213 3.40.630.70
2dpsB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.935 1 57 3.30.70.3550
2z3lB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9334 2 57 3.30.70.3550
af_O96210_178_350_3.40.630.70 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain 0.8856 60 213 3.40.630.70
2dpsB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.8625 1 57 3.30.70.3550
ID Description Score Start End GO Terms
AF-A0A1M3R272-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9962 1 214 GO:0005737
GO:0008914
GO:0030163
AF-A0A7J5WMH9-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein 0.9953 83 213 GO:0005737
GO:0008914
GO:0030163
AF-A0A3C1WWU8-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase 0.9948 68 215 GO:0005737
GO:0008914
GO:0030163
AF-A0A5B8VN66-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9942 1 215 GO:0005737
GO:0008914
GO:0030163
AF-A1ZKU8-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9926 2 214 GO:0005737
GO:0008914
GO:0030163

Map