F174673
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 138 | 110 | 276 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0124855|Ga0500568_0124855_81_857 |
| Length | 258 |
| Sequence | MPVFRLDKRLVFPPVELAEDGLLAVGGDLTPQRLLLGYSQGIFPWYGPKLPILWHSPDPRMVMETRDLIINRSLRKHLRKQPYELRIDTAFTEVLTRCSDVPRPGQDGTWLVPDMVDAYTKLHELGFAHSFEAWSGGELVGGLYGVSLGTCFFGESMFARAPDASKIAFAASVAQLDAWEIRLIDCQVHTDHLARLGATEISRPAFITRLKLALDAPTRRGRWAFEMDLAAWAARGGDWPDAPAAAAPATSTGDGSAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 10 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 14 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 16 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 17 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 18 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 19 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 20 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 21 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 22 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 23 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 24 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 25 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 26 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 40 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 58 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 60 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 61 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 62 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 63 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 64 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 65 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 66 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 67 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 68 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 69 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 70 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 71 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 72 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 73 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 74 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 75 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 76 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 77 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 78 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 79 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 80 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 81 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 82 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 83 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 90 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 91 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 92 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 93 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 94 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 95 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 96 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 97 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 98 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 99 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 100 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 101 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 102 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 103 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 104 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 105 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 106 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 107 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 108 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 109 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 110 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.38 |
| Metatranscriptomes | 0 |
| Isolates | 3.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.35 |
| Nodule | 1.45 |
| Rhizoplane | 0 |
| Rhizosphere | 86.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500568_0124855 | 3300053139 | Bacteria | 958 |
| 2 | rootH2_10053682 | 3300003320 | Bacteria | 6853 |
| 3 | rootH2_10106789 | 3300003320 | Bacteria | 2264 |
| 4 | rootH2_10116842 | 3300003320 | Bacteria | 2374 |
| 5 | rootL2_10213117 | 3300003322 | Unclassified | 2636 |
| 6 | Ga0055542_1004395 | 3300003762 | Bacteria | 3444 |
| 7 | Ga0070683_100007856 | 3300005329 | Bacteria | 9035 |
| 8 | Ga0068868_100588640 | 3300005338 | Bacteria | 984 |
| 9 | Ga0070691_10063568 | 3300005341 | Bacteria | 1779 |
| 10 | Ga0070694_100238910 | 3300005444 | Bacteria | 1370 |
| 11 | Ga0068867_100198685 | 3300005459 | Unclassified | 1604 |
| 12 | Ga0070707_100090721 | 3300005468 | Bacteria | 2958 |
| 13 | Ga0070698_100001798 | 3300005471 | Bacteria | 23864 |
| 14 | Ga0070684_100000851 | 3300005535 | Bacteria | 21510 |
| 15 | Ga0068853_100031174 | 3300005539 | Unclassified | 4509 |
| 16 | Ga0068853_100254023 | 3300005539 | Unclassified | 1614 |
| 17 | Ga0070696_100079028 | 3300005546 | Bacteria | 2327 |
| 18 | Ga0068855_100000420 | 3300005563 | Bacteria | 52301 |
| 19 | Ga0068855_100012457 | 3300005563 | Bacteria | 10268 |
| 20 | Ga0068856_100946163 | 3300005614 | Bacteria | 880 |
| 21 | Ga0068859_100617349 | 3300005617 | Bacteria | 1177 |
| 22 | Ga0068864_100187271 | 3300005618 | Bacteria | 1895 |
| 23 | Ga0068866_10283977 | 3300005718 | Bacteria | 1027 |
| 24 | Ga0068860_100256975 | 3300005843 | Unclassified | 1702 |
| 25 | Ga0068860_101174365 | 3300005843 | Unclassified | 788 |
| 26 | Ga0068862_100175735 | 3300005844 | Unclassified | 1920 |
| 27 | Ga0081540_1024128 | 3300005983 | Bacteria | 3536 |
| 28 | Ga0068871_100441277 | 3300006358 | Bacteria | 1165 |
| 29 | Ga0075428_100068405 | 3300006844 | Bacteria | 3885 |
| 30 | Ga0075431_100433776 | 3300006847 | Bacteria | 1312 |
| 31 | Ga0097620_100617335 | 3300006931 | Bacteria | 1177 |
| 32 | Ga0099826_10042882 | 3300006948 | Bacteria | 3121 |
| 33 | Ga0105240_10000188 | 3300009093 | Bacteria | 126031 |
| 34 | Ga0105240_10002800 | 3300009093 | Bacteria | 27570 |
| 35 | Ga0105240_10010808 | 3300009093 | Bacteria | 12785 |
| 36 | Ga0105240_10037831 | 3300009093 | Bacteria | 6197 |
| 37 | Ga0105240_10274452 | 3300009093 | Bacteria | 1940 |
| 38 | Ga0111539_10896900 | 3300009094 | Bacteria | 1031 |
| 39 | Ga0105243_10227877 | 3300009148 | Unclassified | 1651 |
| 40 | Ga0105238_10058172 | 3300009551 | Unclassified | 3875 |
| 41 | Ga0105239_10000246 | 3300010375 | Bacteria | 80752 |
| 42 | Ga0105239_10000675 | 3300010375 | Bacteria | 48613 |
| 43 | Ga0105239_10111223 | 3300010375 | Bacteria | 3036 |
| 44 | Ga0105239_10157376 | 3300010375 | Bacteria | 2538 |
| 45 | Ga0157370_10306302 | 3300013104 | Unclassified | 1466 |
| 46 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 47 | Ga0157378_10645468 | 3300013297 | Unclassified | 1074 |
| 48 | Ga0157378_10785183 | 3300013297 | Unclassified | 977 |
| 49 | Ga0157372_10019038 | 3300013307 | Bacteria | 7391 |
| 50 | Ga0157380_10000244 | 3300014326 | Bacteria | 32717 |
| 51 | Ga0157380_10066157 | 3300014326 | Bacteria | 2907 |
| 52 | Ga0157376_10119576 | 3300014969 | Bacteria | 2333 |
| 53 | Ga0213872_10022004 | 3300021361 | Bacteria | 2936 |
| 54 | Ga0209258_100068 | 3300025242 | Bacteria | 286288 |
| 55 | Ga0209148_1000343 | 3300025254 | Bacteria | 61260 |
| 56 | Ga0207642_10090304 | 3300025899 | Unclassified | 1511 |
| 57 | Ga0207647_10066107 | 3300025904 | Bacteria | 2193 |
| 58 | Ga0207684_10066022 | 3300025910 | Bacteria | 3073 |
| 59 | Ga0207695_10000016 | 3300025913 | Bacteria | 771991 |
| 60 | Ga0207695_10000060 | 3300025913 | Bacteria | 360217 |
| 61 | Ga0207695_10000284 | 3300025913 | Bacteria | 126041 |
| 62 | Ga0207695_10064547 | 3300025913 | Bacteria | 3769 |
| 63 | Ga0207695_10128094 | 3300025913 | Bacteria | 2498 |
| 64 | Ga0207695_10418324 | 3300025913 | Bacteria | 1224 |
| 65 | Ga0207646_10323264 | 3300025922 | Bacteria | 1394 |
| 66 | Ga0207694_10041525 | 3300025924 | Unclassified | 3545 |
| 67 | Ga0207659_10823170 | 3300025926 | Bacteria | 798 |
| 68 | Ga0207689_10007831 | 3300025942 | Bacteria | 9338 |
| 69 | Ga0207689_10057208 | 3300025942 | Bacteria | 3208 |
| 70 | Ga0207661_10028123 | 3300025944 | Bacteria | 4302 |
| 71 | Ga0207661_10500211 | 3300025944 | Unclassified | 1110 |
| 72 | Ga0207667_10000241 | 3300025949 | Bacteria | 76753 |
| 73 | Ga0207667_10007482 | 3300025949 | Bacteria | 13115 |
| 74 | Ga0207639_10265314 | 3300026041 | Unclassified | 1504 |
| 75 | Ga0207702_11065160 | 3300026078 | Unclassified | 802 |
| 76 | Ga0207648_10037817 | 3300026089 | Bacteria | 4249 |
| 77 | Ga0207676_10054117 | 3300026095 | Bacteria | 3144 |
| 78 | Ga0207674_10194519 | 3300026116 | Bacteria | 1978 |
| 79 | Ga0209282_1012181 | 3300027666 | Bacteria | 5467 |
| 80 | Ga0268264_10450778 | 3300028381 | Unclassified | 1246 |
| 81 | Ga0316177_1015668 | 3300030731 | Unclassified | 1476 |
| 82 | Ga0265332_10003131 | 3300031238 | Bacteria | 8061 |
| 83 | Ga0265339_10010310 | 3300031249 | Bacteria | 5811 |
| 84 | Ga0265316_10009145 | 3300031344 | Bacteria | 9128 |
| 85 | Ga0265314_10000003 | 3300031711 | Bacteria | 1653386 |
| 86 | Ga0307416_100002787 | 3300032002 | Bacteria | 10148 |
| 87 | Ga0307510_10001098 | 3300033180 | Bacteria | 28868 |
| 88 | Ga0395905_0138738 | 3300037471 | Bacteria | 2288 |
| 89 | Ga0400490_29571 | 3300038726 | Bacteria | 33032 |
| 90 | Ga0400491_06162 | 3300038727 | Bacteria | 2926 |
| 91 | Ga0436365_0955065 | 3300039437 | Bacteria | 1492 |
| 92 | Ga0436365_0962331 | 3300039437 | Bacteria | 1458 |
| 93 | Ga0436361_0185139 | 3300039447 | Bacteria | 11803 |
| 94 | Ga0439465_0056027 | 3300041413 | Bacteria | 1299 |
| 95 | Ga0439431_0131734 | 3300041997 | Unclassified | 702 |
| 96 | Ga0439433_0049593 | 3300041999 | Bacteria | 988 |
| 97 | Ga0439462_0039537 | 3300042015 | Unclassified | 1258 |
| 98 | Ga0450894_011169 | 3300042131 | Bacteria | 1168 |
| 99 | Ga0450898_020883 | 3300042134 | Bacteria | 1150 |
| 100 | Ga0439434_0004914 | 3300042435 | Bacteria | 3909 |
| 101 | Ga0451577_0003363 | 3300042876 | Bacteria | 17899 |
| 102 | Ga0451577_0641774 | 3300042876 | Bacteria | 963 |
| 103 | Ga0453683_0125453 | 3300044673 | Bacteria | 1616 |
| 104 | Ga0453684_0011892 | 3300044712 | Bacteria | 14492 |
| 105 | Ga0466970_0153984 | 3300044765 | Bacteria | 1270 |
| 106 | Ga0451576_0000022 | 3300045051 | Bacteria | 495037 |
| 107 | Ga0495606_0018209 | 3300046507 | Bacteria | 5277 |
| 108 | Ga0495643_0054284 | 3300046522 | Bacteria | 2146 |
| 109 | Ga0495611_0000115 | 3300046648 | Bacteria | 56623 |
| 110 | Ga0495588_0104508 | 3300046674 | Bacteria | 1490 |
| 111 | Ga0495687_010408 | 3300047443 | Bacteria | 5102 |
| 112 | Ga0495686_0000195 | 3300047472 | Bacteria | 113003 |
| 113 | Ga0495686_0044333 | 3300047472 | Bacteria | 2816 |
| 114 | Ga0501033_0159455 | 3300049570 | Unclassified | 1624 |
| 115 | Ga0501034_0035245 | 3300049571 | Bacteria | 5073 |
| 116 | Ga0501034_0743311 | 3300049571 | Bacteria | 877 |
| 117 | Ga0501036_0296999 | 3300049572 | Bacteria | 1351 |
| 118 | Ga0501037_0140059 | 3300049573 | Unclassified | 1732 |
| 119 | Ga0501043_0097813 | 3300049579 | Bacteria | 2307 |
| 120 | Ga0501046_0533304 | 3300049580 | Unclassified | 838 |
| 121 | Ga0501047_0488699 | 3300049581 | Unclassified | 1058 |
| 122 | Ga0501067_0082769 | 3300049583 | Bacteria | 1780 |
| 123 | Ga0501069_0031634 | 3300049585 | Bacteria | 2912 |
| 124 | Ga0501070_0115361 | 3300049586 | Bacteria | 2218 |
| 125 | Ga0501070_0158463 | 3300049586 | Bacteria | 1866 |
| 126 | Ga0501083_0024993 | 3300049744 | Bacteria | 4137 |
| 127 | Ga0501035_0179182 | 3300049822 | Bacteria | 1827 |
| 128 | Ga0501044_0024837 | 3300049823 | Bacteria | 6357 |
| 129 | Ga0501044_0078498 | 3300049823 | Bacteria | 3345 |
| 130 | nmdc:mga05p37_308882_c1 | 3300050507 | Bacteria | 1875 |
| 131 | Ga0500641_0030423 | 3300053096 | Unclassified | 2122 |
| 132 | Ga0500607_009503 | 3300053121 | Bacteria | 5847 |
| 133 | Ga0501082_0294371 | 3300060353 | Bacteria | 1413 |
| 134 | 2520881007 | 2519899754 | Bacteria | 5336938 |
| 135 | 2817414666 | 2816332280 | Bacteria | 5109718 |
| 136 | 2883071138 | 2883068021 | Bacteria | 6192739 |
| 137 | 2903895749 | 2903895155 | Bacteria | 5258610 |
| 138 | 2958462643 | 2958458903 | Bacteria | 5301041 |
| 139 | Ga0500568_0124855 | |||
| 140 | rootH2_10053682 | |||
| 141 | rootH2_10106789 | |||
| 142 | rootH2_10116842 | |||
| 143 | rootL2_10213117 | |||
| 144 | Ga0055542_1004395 | |||
| 145 | Ga0070683_100007856 | |||
| 146 | Ga0068868_100588640 | |||
| 147 | Ga0070691_10063568 | |||
| 148 | Ga0070694_100238910 | |||
| 149 | Ga0068867_100198685 | |||
| 150 | Ga0070707_100090721 | |||
| 151 | Ga0070698_100001798 | |||
| 152 | Ga0070684_100000851 | |||
| 153 | Ga0068853_100031174 | |||
| 154 | Ga0068853_100254023 | |||
| 155 | Ga0070696_100079028 | |||
| 156 | Ga0068855_100000420 | |||
| 157 | Ga0068855_100012457 | |||
| 158 | Ga0068856_100946163 | |||
| 159 | Ga0068859_100617349 | |||
| 160 | Ga0068864_100187271 | |||
| 161 | Ga0068866_10283977 | |||
| 162 | Ga0068860_100256975 | |||
| 163 | Ga0068860_101174365 | |||
| 164 | Ga0068862_100175735 | |||
| 165 | Ga0081540_1024128 | |||
| 166 | Ga0068871_100441277 | |||
| 167 | Ga0075428_100068405 | |||
| 168 | Ga0075431_100433776 | |||
| 169 | Ga0097620_100617335 | |||
| 170 | Ga0099826_10042882 | |||
| 171 | Ga0105240_10000188 | |||
| 172 | Ga0105240_10002800 | |||
| 173 | Ga0105240_10010808 | |||
| 174 | Ga0105240_10037831 | |||
| 175 | Ga0105240_10274452 | |||
| 176 | Ga0111539_10896900 | |||
| 177 | Ga0105243_10227877 | |||
| 178 | Ga0105238_10058172 | |||
| 179 | Ga0105239_10000246 | |||
| 180 | Ga0105239_10000675 | |||
| 181 | Ga0105239_10111223 | |||
| 182 | Ga0105239_10157376 | |||
| 183 | Ga0157370_10306302 | |||
| 184 | Ga0157374_10000002 | |||
| 185 | Ga0157378_10645468 | |||
| 186 | Ga0157378_10785183 | |||
| 187 | Ga0157372_10019038 | |||
| 188 | Ga0157380_10000244 | |||
| 189 | Ga0157380_10066157 | |||
| 190 | Ga0157376_10119576 | |||
| 191 | Ga0213872_10022004 | |||
| 192 | Ga0209258_100068 | |||
| 193 | Ga0209148_1000343 | |||
| 194 | Ga0207642_10090304 | |||
| 195 | Ga0207647_10066107 | |||
| 196 | Ga0207684_10066022 | |||
| 197 | Ga0207695_10000016 | |||
| 198 | Ga0207695_10000060 | |||
| 199 | Ga0207695_10000284 | |||
| 200 | Ga0207695_10064547 | |||
| 201 | Ga0207695_10128094 | |||
| 202 | Ga0207695_10418324 | |||
| 203 | Ga0207646_10323264 | |||
| 204 | Ga0207694_10041525 | |||
| 205 | Ga0207659_10823170 | |||
| 206 | Ga0207689_10007831 | |||
| 207 | Ga0207689_10057208 | |||
| 208 | Ga0207661_10028123 | |||
| 209 | Ga0207661_10500211 | |||
| 210 | Ga0207667_10000241 | |||
| 211 | Ga0207667_10007482 | |||
| 212 | Ga0207639_10265314 | |||
| 213 | Ga0207702_11065160 | |||
| 214 | Ga0207648_10037817 | |||
| 215 | Ga0207676_10054117 | |||
| 216 | Ga0207674_10194519 | |||
| 217 | Ga0209282_1012181 | |||
| 218 | Ga0268264_10450778 | |||
| 219 | Ga0316177_1015668 | |||
| 220 | Ga0265332_10003131 | |||
| 221 | Ga0265339_10010310 | |||
| 222 | Ga0265316_10009145 | |||
| 223 | Ga0265314_10000003 | |||
| 224 | Ga0307416_100002787 | |||
| 225 | Ga0307510_10001098 | |||
| 226 | Ga0395905_0138738 | |||
| 227 | Ga0400490_29571 | |||
| 228 | Ga0400491_06162 | |||
| 229 | Ga0436365_0955065 | |||
| 230 | Ga0436365_0962331 | |||
| 231 | Ga0436361_0185139 | |||
| 232 | Ga0439465_0056027 | |||
| 233 | Ga0439431_0131734 | |||
| 234 | Ga0439433_0049593 | |||
| 235 | Ga0439462_0039537 | |||
| 236 | Ga0450894_011169 | |||
| 237 | Ga0450898_020883 | |||
| 238 | Ga0439434_0004914 | |||
| 239 | Ga0451577_0003363 | |||
| 240 | Ga0451577_0641774 | |||
| 241 | Ga0453683_0125453 | |||
| 242 | Ga0453684_0011892 | |||
| 243 | Ga0466970_0153984 | |||
| 244 | Ga0451576_0000022 | |||
| 245 | Ga0495606_0018209 | |||
| 246 | Ga0495643_0054284 | |||
| 247 | Ga0495611_0000115 | |||
| 248 | Ga0495588_0104508 | |||
| 249 | Ga0495687_010408 | |||
| 250 | Ga0495686_0000195 | |||
| 251 | Ga0495686_0044333 | |||
| 252 | Ga0501033_0159455 | |||
| 253 | Ga0501034_0035245 | |||
| 254 | Ga0501034_0743311 | |||
| 255 | Ga0501036_0296999 | |||
| 256 | Ga0501037_0140059 | |||
| 257 | Ga0501043_0097813 | |||
| 258 | Ga0501046_0533304 | |||
| 259 | Ga0501047_0488699 | |||
| 260 | Ga0501067_0082769 | |||
| 261 | Ga0501069_0031634 | |||
| 262 | Ga0501070_0115361 | |||
| 263 | Ga0501070_0158463 | |||
| 264 | Ga0501083_0024993 | |||
| 265 | Ga0501035_0179182 | |||
| 266 | Ga0501044_0024837 | |||
| 267 | Ga0501044_0078498 | |||
| 268 | nmdc:mga05p37_308882_c1 | |||
| 269 | Ga0500641_0030423 | |||
| 270 | Ga0500607_009503 | |||
| 271 | Ga0501082_0294371 | |||
| 272 | 2520881007 | |||
| 273 | 2817414666 | |||
| 274 | 2883071138 | |||
| 275 | 2903895749 | |||
| 276 | 2958462643 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z3o-assembly1.cif.gz_A | complex structure of lf-transferase and phenylalanine | 0.9505 | 2 | 213 |
| 2cxa-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9463 | 1 | 213 |
| 2dps-assembly1.cif.gz_A | structure of leucyl/phenylalanyl-trna-protein transferase | 0.9408 | 3 | 213 |
| 2z3l-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9385 | 2 | 213 |
| 2z3n-assembly1.cif.gz_B | complex structure of lf-transferase and peptide b | 0.9354 | 2 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2z3kA02 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain | 0.9551 | 58 | 213 | 3.40.630.70 |
| 2dpsB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain | 0.935 | 1 | 57 | 3.30.70.3550 |
| 2z3lB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain | 0.9334 | 2 | 57 | 3.30.70.3550 |
| af_O96210_178_350_3.40.630.70 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain | 0.8856 | 60 | 213 | 3.40.630.70 |
| 2dpsB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain | 0.8625 | 1 | 57 | 3.30.70.3550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M3R272-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) | 0.9962 | 1 | 214 |
GO:0005737
GO:0008914 GO:0030163 |
| AF-A0A7J5WMH9-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein | 0.9953 | 83 | 213 |
GO:0005737
GO:0008914 GO:0030163 |
| AF-A0A3C1WWU8-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein transferase | 0.9948 | 68 | 215 |
GO:0005737
GO:0008914 GO:0030163 |
| AF-A0A5B8VN66-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) | 0.9942 | 1 | 215 |
GO:0005737
GO:0008914 GO:0030163 |
| AF-A1ZKU8-F1-model_v4 | Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) | 0.9926 | 2 | 214 |
GO:0005737
GO:0008914 GO:0030163 |