F174997

General Info

Members Datasets Scaffolds Average Seq Length
139 118 278 338

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10020004|rootH1_100200047
Length 350
Sequence MPDTLKTILAIRFSAMGDVAMTIPVMQQVLEQHPDIQIVFVSNKNWGALCAGIPRLIFFPADLKGAHKGFKGLYQLFKSIRQAHKIDAVADLHHVLRSQIVRTFFRLRGVPVAAIDKGRAEKKALARPEEKVLMPLTGTIERYATVFRQLGLSVIINPLRPVFGRQMLTEDMLAVTGPKEKDKWIGLAPFATYKEKTYPLEKMEDVLAALVRRSHTKVLLMGGGSSEVAQLTALAIKYPAAIIVAGQFRLPEEMAIISNLDVMISMDSANMHLASLFGVPVVSVWGATHPYAGFMGFGQSEANAVQLESLSCRPCSIFGNKPCFRGDHACMEWIPPAAITDKVLKVAGQQ

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
83 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
84 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
85 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
86 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
87 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
92 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
93 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
96 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
97 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
98 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
99 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
100 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
101 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
102 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
103 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
104 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
105 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
106 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
107 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
108 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
109 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
110 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
111 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
112 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
113 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
114 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
115 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
116 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
117 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
118 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.93
Metatranscriptomes 0
Isolates 10.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.9
Nodule 0
Rhizoplane 0
Rhizosphere 58.27
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10020004 3300003316 Bacteria 9874
2 JGI24740J21852_10004962 3300001979 Bacteria 5658
3 JGI25154J39366_1000001 3300002738 Bacteria 483450
4 JGI25159J45721_1019427 3300002987 Bacteria 1337
5 JGI25153J46596_10011612 3300003215 Bacteria 3876
6 rootH2_10004707 3300003320 Bacteria 19403
7 rootH2_10058614 3300003320 Bacteria 4809
8 rootL2_10169259 3300003322 Bacteria 1881
9 rootL2_10209217 3300003322 Bacteria 3696
10 rootH1_10006952 3300003323 Bacteria 18299
11 rootH1_10008724 3300003323 Bacteria 8118
12 JGI25160J50197_1004817 3300003354 Bacteria 5755
13 JGI25160J50197_1014307 3300003354 Bacteria 2660
14 Ga0055535_1002354 3300003761 Bacteria 6820
15 Ga0055542_1002590 3300003762 Bacteria 5725
16 Ga0055526_1024185 3300003771 Bacteria 1998
17 Ga0055528_1000359 3300003790 Bacteria 37077
18 Ga0055531_10000045 3300003794 Bacteria 132131
19 Ga0065165_1000112 3300005262 Bacteria 135988
20 Ga0065165_1008627 3300005262 Bacteria 4729
21 Ga0065165_1018922 3300005262 Bacteria 2476
22 Ga0065714_10080909 3300005288 Bacteria 2409
23 Ga0065704_10101299 3300005289 Bacteria 2241
24 Ga0070676_10058474 3300005328 Bacteria 2285
25 Ga0070670_100009422 3300005331 Bacteria 8337
26 Ga0068869_100019734 3300005334 Bacteria 4612
27 Ga0070689_100015793 3300005340 Bacteria 5515
28 Ga0070668_100021739 3300005347 Bacteria 4847
29 Ga0070668_100058631 3300005347 Bacteria 2979
30 Ga0070669_100004598 3300005353 Bacteria 9963
31 Ga0070669_100025703 3300005353 Bacteria 4230
32 Ga0070675_100050448 3300005354 Bacteria 3416
33 Ga0070674_100074880 3300005356 Bacteria 2403
34 Ga0070700_100027733 3300005441 Bacteria 3361
35 Ga0070663_100037297 3300005455 Bacteria 3383
36 Ga0070662_100208566 3300005457 Bacteria 1554
37 Ga0068867_100010794 3300005459 Bacteria 6444
38 Ga0070698_100176752 3300005471 Bacteria 2074
39 Ga0070672_100060445 3300005543 Bacteria 2983
40 Ga0070672_100381072 3300005543 Bacteria 1206
41 Ga0070664_100232607 3300005564 Bacteria 1652
42 Ga0068854_100398119 3300005578 Bacteria 1139
43 Ga0068859_100312874 3300005617 Bacteria 1664
44 Ga0068866_10021457 3300005718 Bacteria 2975
45 Ga0068861_100092990 3300005719 Bacteria 2383
46 Ga0068870_10037178 3300005840 Bacteria 2508
47 Ga0068871_100088867 3300006358 Bacteria 2572
48 Ga0097620_100312862 3300006931 Bacteria 1664
49 Ga0105243_10334709 3300009148 Bacteria 1384
50 Ga0105242_10081977 3300009176 Bacteria 2699
51 Ga0105249_10021899 3300009553 Bacteria 5723
52 Ga0105249_10426428 3300009553 Bacteria 1361
53 Ga0157373_10218842 3300013100 Bacteria 1343
54 Ga0157378_10047195 3300013297 Bacteria 3828
55 Ga0157378_10242277 3300013297 Bacteria 1723
56 Ga0163162_10160263 3300013306 Unclassified 2371
57 Ga0163162_10174648 3300013306 Bacteria 2274
58 Ga0157375_10013642 3300013308 Bacteria 7242
59 Ga0157375_10163306 3300013308 Bacteria 2371
60 Ga0157375_10193138 3300013308 Bacteria 2191
61 Ga0157380_10001574 3300014326 Bacteria 15001
62 Ga0157377_10001511 3300014745 Bacteria 10084
63 Ga0157376_10228466 3300014969 Bacteria 1727
64 Ga0182005_1000076 3300015265 Bacteria 79167
65 Ga0209436_102554 3300025208 Bacteria 5381
66 Ga0209258_100041 3300025242 Bacteria 381381
67 Ga0209646_1000002 3300025246 Bacteria 1425781
68 Ga0209026_1000218 3300025250 Bacteria 79205
69 Ga0209148_1000375 3300025254 Bacteria 54278
70 Ga0209673_1000096 3300025273 Bacteria 194819
71 Ga0209130_1001124 3300025284 Bacteria 19660
72 Ga0209564_1001415 3300025295 Bacteria 24742
73 Ga0209758_1001132 3300025297 Bacteria 34267
74 Ga0209758_1003569 3300025297 Bacteria 13961
75 Ga0209758_1024723 3300025297 Bacteria 2665
76 Ga0209050_1000207 3300025298 Bacteria 131328
77 Ga0207426_1000275 3300025302 Bacteria 106256
78 Ga0207426_1000699 3300025302 Bacteria 39800
79 Ga0207426_1001471 3300025302 Bacteria 19401
80 Ga0209257_1000001 3300025304 Bacteria 2274655
81 Ga0209257_1001870 3300025304 Bacteria 22825
82 Ga0207680_10132284 3300025903 Bacteria 1645
83 Ga0207645_10042561 3300025907 Bacteria 2906
84 Ga0207643_10043148 3300025908 Bacteria 2544
85 Ga0207681_10027393 3300025923 Bacteria 3684
86 Ga0207681_10089903 3300025923 Bacteria 2190
87 Ga0207706_10036843 3300025933 Bacteria 4345
88 Ga0207670_10023953 3300025936 Bacteria 3808
89 Ga0207691_10028065 3300025940 Bacteria 5272
90 Ga0207691_10118307 3300025940 Bacteria 2350
91 Ga0207689_10135168 3300025942 Bacteria 2030
92 Ga0207679_10048352 3300025945 Bacteria 3096
93 Ga0207651_10022312 3300025960 Bacteria 3868
94 Ga0207668_10045936 3300025972 Bacteria 2981
95 Ga0207678_10040210 3300026067 Bacteria 4057
96 Ga0207648_10007442 3300026089 Bacteria 10767
97 Ga0207674_10040096 3300026116 Bacteria 4853
98 Ga0207675_100001768 3300026118 Bacteria 21608
99 Ga0268264_10158013 3300028381 Bacteria 2039
100 Ga0307416_100511161 3300032002 Unclassified 1268
101 Ga0307414_10124472 3300032004 Bacteria 1989
102 Ga0439465_0007660 3300041413 Bacteria 3427
103 Ga0439431_0015242 3300041997 Bacteria 1788
104 Ga0439433_0043610 3300041999 Unclassified 1048
105 Ga0439434_0001225 3300042435 Bacteria 7392
106 Ga0495633_0000336 3300046558 Bacteria 52701
107 Ga0495611_0020407 3300046648 Bacteria 2852
108 Ga0496121_0000030 3300048924 Bacteria 412079
109 Ga0496126_0048703 3300048929 Bacteria 3871
110 Ga0501298_009580 3300049521 Bacteria 1651
111 Ga0501047_0187000 3300049581 Bacteria 1936
112 Ga0501223_001143 3300049663 Bacteria 6252
113 Ga0501243_000554 3300049675 Bacteria 5023
114 Ga0501259_000168 3300049688 Bacteria 9927
115 Ga0501044_0104207 3300049823 Bacteria 2851
116 Ga0501212_016569 3300049851 Unclassified 1108
117 Ga0500644_0000160 3300053088 Bacteria 42538
118 Ga0500641_0054650 3300053096 Bacteria 1651
119 Ga0500569_000279 3300053109 Bacteria 8070
120 Ga0500607_053622 3300053121 Bacteria 2137
121 Ga0500658_0004336 3300053134 Bacteria 5318
122 Ga0500568_0000606 3300053139 Bacteria 25992
123 Ga0500616_0018948 3300053153 Bacteria 3887
124 Ga0500622_0000220 3300053156 Bacteria 60029
125 Ga0500661_005441 3300055283 Bacteria 2380
126 2819573435 2818991442 Bacteria 8318214
127 2819680942 2818991460 Bacteria 7595395
128 2821136856 2821136567 Bacteria 8080116
129 2883072549 2883068021 Bacteria 6192739
130 2884795722 2884791551 Bacteria 8511252
131 2896087680 2896085136 Bacteria 6129793
132 2896112592 2896109856 Bacteria 7140722
133 2904468400 2904467357 Bacteria 8057758
134 2929178716 2929177148 Bacteria 7883697
135 2929241074 2929239360 Bacteria 7745570
136 2929923103 2929921140 Bacteria 8649150
137 2945981128 2945977869 Bacteria 7777518
138 2946019472 2946013367 Bacteria 7766675
139 8003156917 8003151029 Bacteria 8187759
140 rootH1_10020004
141 JGI24740J21852_10004962
142 JGI25154J39366_1000001
143 JGI25159J45721_1019427
144 JGI25153J46596_10011612
145 rootH2_10004707
146 rootH2_10058614
147 rootL2_10169259
148 rootL2_10209217
149 rootH1_10006952
150 rootH1_10008724
151 JGI25160J50197_1004817
152 JGI25160J50197_1014307
153 Ga0055535_1002354
154 Ga0055542_1002590
155 Ga0055526_1024185
156 Ga0055528_1000359
157 Ga0055531_10000045
158 Ga0065165_1000112
159 Ga0065165_1008627
160 Ga0065165_1018922
161 Ga0065714_10080909
162 Ga0065704_10101299
163 Ga0070676_10058474
164 Ga0070670_100009422
165 Ga0068869_100019734
166 Ga0070689_100015793
167 Ga0070668_100021739
168 Ga0070668_100058631
169 Ga0070669_100004598
170 Ga0070669_100025703
171 Ga0070675_100050448
172 Ga0070674_100074880
173 Ga0070700_100027733
174 Ga0070663_100037297
175 Ga0070662_100208566
176 Ga0068867_100010794
177 Ga0070698_100176752
178 Ga0070672_100060445
179 Ga0070672_100381072
180 Ga0070664_100232607
181 Ga0068854_100398119
182 Ga0068859_100312874
183 Ga0068866_10021457
184 Ga0068861_100092990
185 Ga0068870_10037178
186 Ga0068871_100088867
187 Ga0097620_100312862
188 Ga0105243_10334709
189 Ga0105242_10081977
190 Ga0105249_10021899
191 Ga0105249_10426428
192 Ga0157373_10218842
193 Ga0157378_10047195
194 Ga0157378_10242277
195 Ga0163162_10160263
196 Ga0163162_10174648
197 Ga0157375_10013642
198 Ga0157375_10163306
199 Ga0157375_10193138
200 Ga0157380_10001574
201 Ga0157377_10001511
202 Ga0157376_10228466
203 Ga0182005_1000076
204 Ga0209436_102554
205 Ga0209258_100041
206 Ga0209646_1000002
207 Ga0209026_1000218
208 Ga0209148_1000375
209 Ga0209673_1000096
210 Ga0209130_1001124
211 Ga0209564_1001415
212 Ga0209758_1001132
213 Ga0209758_1003569
214 Ga0209758_1024723
215 Ga0209050_1000207
216 Ga0207426_1000275
217 Ga0207426_1000699
218 Ga0207426_1001471
219 Ga0209257_1000001
220 Ga0209257_1001870
221 Ga0207680_10132284
222 Ga0207645_10042561
223 Ga0207643_10043148
224 Ga0207681_10027393
225 Ga0207681_10089903
226 Ga0207706_10036843
227 Ga0207670_10023953
228 Ga0207691_10028065
229 Ga0207691_10118307
230 Ga0207689_10135168
231 Ga0207679_10048352
232 Ga0207651_10022312
233 Ga0207668_10045936
234 Ga0207678_10040210
235 Ga0207648_10007442
236 Ga0207674_10040096
237 Ga0207675_100001768
238 Ga0268264_10158013
239 Ga0307416_100511161
240 Ga0307414_10124472
241 Ga0439465_0007660
242 Ga0439431_0015242
243 Ga0439433_0043610
244 Ga0439434_0001225
245 Ga0495633_0000336
246 Ga0495611_0020407
247 Ga0496121_0000030
248 Ga0496126_0048703
249 Ga0501298_009580
250 Ga0501047_0187000
251 Ga0501223_001143
252 Ga0501243_000554
253 Ga0501259_000168
254 Ga0501044_0104207
255 Ga0501212_016569
256 Ga0500644_0000160
257 Ga0500641_0054650
258 Ga0500569_000279
259 Ga0500607_053622
260 Ga0500658_0004336
261 Ga0500568_0000606
262 Ga0500616_0018948
263 Ga0500622_0000220
264 Ga0500661_005441
265 2819573435
266 2819680942
267 2821136856
268 2883072549
269 2884795722
270 2896087680
271 2896112592
272 2904468400
273 2929178716
274 2929241074
275 2929923103
276 2945981128
277 2946019472
278 8003156917

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01075

Glyco_transf_9

Glycosyltransferase family 9 (heptosyltransferase)

73

320

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tov-assembly2.cif.gz_B the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.7498 2 342
2h1f-assembly2.cif.gz_B e. coli heptosyltransferase waac with adp 0.7455 3 339
6dfe-assembly1.cif.gz_A the structure of a ternary complex of e. coli waac 0.7425 3 343
6dfe-assembly1.cif.gz_A the structure of a ternary complex of e. coli waac 0.7404 3 343
3tov-assembly2.cif.gz_B the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.7339 2 342
ID Description Score Start End Superfamily
4ovjA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8665 4 40 3.40.190.10
2h1fB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8368 179 339 3.40.50.2000
3tovB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7954 168 342 3.40.50.2000
1pswA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7704 176 342 3.40.50.2000
af_A0A0N7KD23_75_238_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7674 5 111 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A839IZC1-F1-model_v4 ADP-heptose--LPS heptosyltransferase RfaF 0.9613 2 96 GO:0005829
GO:0008713
GO:0009244
AF-M6RDB6-F1-model_v4 Heptosyltransferase domain protein 0.9589 9 157 GO:0005829
GO:0008713
GO:0009244
AF-A0A520HN27-F1-model_v4 Ribonucleotide reductase large subunit C-terminal domain-containing protein 0.9566 3 155 GO:0004748
GO:0005524
GO:0005971
GO:0009263
AF-A0A3D6BMC1-F1-model_v4 ADP-heptose--LPS heptosyltransferase RfaF 0.956 14 268 GO:0005829
GO:0008713
GO:0009244
AF-A0A641W5T1-F1-model_v4 deleted 0.9539 3 115

Map