F176580

General Info

Members Datasets Scaffolds Average Seq Length
139 112 139 356

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10002000|Ga0207639_1000200016
Length 398
Sequence VPSGSPVPPPLCAPAHIDFPFGPCTVAAISSPAVRILYGVVGEGMGHAMRSRVILDELTKRHQVQVVVSGRAYDYLKARASERLAVEKIWGYSLVYEDNQVRKFKTLLENVKGALRGWPRNVRAYFDLAEKFQPDVVISDFESWSYLFAKNHRLPVISVDNMQIIDRCRHAPAIVKGVGAEMKLTQAIVKTKVAGAFHYFITTFFRPPVRLKRTSLHPPILRPEILAARPEAGGHLLVYQTSTSNRALPKILEASGIECRVYGLRRDLKADVREGNVLYRPFSEAGFIDDLRTARGVIASAGFTLMGEAVYLRRPMLAIPVKKQFEQVLNARYLEAESYGLGAEAISGARLGEFVERLPEFERALAGYSQDGNRDLLGALEAGLVAASSGAKGMFPES

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
53 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
54 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
61 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
62 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
67 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
68 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
73 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
96 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
105 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
106 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
107 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
108 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
109 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
110 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.6
Nodule 0
Rhizoplane 2.88
Rhizosphere 88.49
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10125983 3300003323 Bacteria 1686
2 Ga0070683_100104415 3300005329 Bacteria 2671
3 Ga0070670_100054522 3300005331 Unclassified 3433
4 Ga0070670_100081531 3300005331 Bacteria 2780
5 Ga0070689_100000004 3300005340 Bacteria 497771
6 Ga0070687_100004913 3300005343 Bacteria 5366
7 Ga0070675_100399024 3300005354 Bacteria 1227
8 Ga0070688_100112167 3300005365 Bacteria 1815
9 Ga0070663_100008109 3300005455 Bacteria 6443
10 Ga0070697_100030275 3300005536 Bacteria 4348
11 Ga0068853_100010422 3300005539 Bacteria 7521
12 Ga0068859_100015584 3300005617 Bacteria 7639
13 Ga0068861_100025083 3300005719 Bacteria 4319
14 Ga0068863_100065820 3300005841 Bacteria 3429
15 Ga0068858_100128398 3300005842 Bacteria 2376
16 Ga0068860_100002508 3300005843 Bacteria 19267
17 Ga0068862_100199897 3300005844 Bacteria 1802
18 Ga0070717_10237745 3300006028 Bacteria 1605
19 Ga0075428_100156098 3300006844 Bacteria 2479
20 Ga0075431_100150585 3300006847 Bacteria 2396
21 Ga0075431_100252972 3300006847 Bacteria 1789
22 Ga0075433_10067079 3300006852 Bacteria 3149
23 Ga0075429_100041163 3300006880 Bacteria 4024
24 Ga0097620_100015584 3300006931 Bacteria 7639
25 Ga0099794_10007091 3300007265 Bacteria 4581
26 Ga0099794_10014212 3300007265 Bacteria 3483
27 Ga0111539_10002186 3300009094 Bacteria 26120
28 Ga0114129_10006346 3300009147 Bacteria 16767
29 Ga0105248_10234841 3300009177 Bacteria 2064
30 Ga0105238_10032673 3300009551 Bacteria 5295
31 Ga0105238_10315501 3300009551 Bacteria 1549
32 Ga0105249_10324474 3300009553 Bacteria 1551
33 Ga0157374_10179214 3300013296 Bacteria 2069
34 Ga0157378_10064207 3300013297 Bacteria 3283
35 Ga0157379_10103450 3300014968 Bacteria 2556
36 Ga0207707_10231542 3300025912 Bacteria 1607
37 Ga0207662_10009397 3300025918 Bacteria 5377
38 Ga0207646_10123633 3300025922 Bacteria 2326
39 Ga0207694_10067681 3300025924 Bacteria 2788
40 Ga0207650_10011345 3300025925 Bacteria 6133
41 Ga0207659_10185427 3300025926 Bacteria 1652
42 Ga0207670_10000007 3300025936 Bacteria 376171
43 Ga0207670_10146013 3300025936 Bacteria 1749
44 Ga0207704_10231535 3300025938 Bacteria 1374
45 Ga0207691_10022827 3300025940 Bacteria 5898
46 Ga0207711_10357817 3300025941 Bacteria 1352
47 Ga0207661_10008273 3300025944 Bacteria 7432
48 Ga0207651_10057526 3300025960 Bacteria 2682
49 Ga0207651_10216534 3300025960 Bacteria 1545
50 Ga0207668_10044947 3300025972 Bacteria 3009
51 Ga0207677_10147161 3300026023 Bacteria 1812
52 Ga0207703_10047002 3300026035 Bacteria 3478
53 Ga0207639_10002000 3300026041 Bacteria 13742
54 Ga0207676_10258202 3300026095 Bacteria 1572
55 Ga0207675_100039685 3300026118 Bacteria 4394
56 Ga0207428_10048918 3300027907 Bacteria 3390
57 Ga0268264_10038140 3300028381 Unclassified 3964
58 Ga0265326_10002115 3300028558 Bacteria 6764
59 Ga0265334_10003931 3300028573 Bacteria 6694
60 Ga0307517_10009080 3300028786 Bacteria 14165
61 Ga0265338_10073776 3300028800 Bacteria 2906
62 Ga0265338_10242294 3300028800 Bacteria 1335
63 Ga0265330_10000336 3300031235 Bacteria 33723
64 Ga0265330_10025301 3300031235 Bacteria 2691
65 Ga0265332_10021933 3300031238 Bacteria 2820
66 Ga0265329_10003257 3300031242 Bacteria 7112
67 Ga0265316_10000565 3300031344 Bacteria 41380
68 Ga0265316_10215769 3300031344 Bacteria 1417
69 Ga0307513_10011656 3300031456 Bacteria 10907
70 Ga0307509_10000010 3300031507 Bacteria 307427
71 Ga0307508_10080551 3300031616 Bacteria 2838
72 Ga0265314_10008840 3300031711 Bacteria 8602
73 Ga0265342_10006048 3300031712 Bacteria 9081
74 Ga0316576_10041036 3300031727 Bacteria 3329
75 Ga0316576_10075235 3300031727 Bacteria 2498
76 Ga0307507_10043198 3300033179 Bacteria 4477
77 Ga0373950_0000014 3300034818 Bacteria 284896
78 Ga0373936_0000002 3300035113 Bacteria 452874
79 Ga0373954_0005670 3300035118 Bacteria 5413
80 Ga0373954_0054293 3300035118 Unclassified 1884
81 Ga0373943_0068696 3300035170 Bacteria 1789
82 Ga0373955_0011373 3300035172 Bacteria 4238
83 Ga0373961_0000073 3300035241 Bacteria 54250
84 Ga0316574_0072823 3300035398 Bacteria 2172
85 Ga0373935_0111167 3300035692 Bacteria 1819
86 Ga0373933_0008701 3300035724 Bacteria 5535
87 Ga0373947_0020794 3300035725 Bacteria 3793
88 Ga0373937_0010515 3300036401 Bacteria 8079
89 Ga0373937_0055606 3300036401 Unclassified 3633
90 Ga0373937_0151669 3300036401 Bacteria 2171
91 Ga0395899_0004859 3300037312 Bacteria 10469
92 Ga0395900_0044586 3300037418 Bacteria 4568
93 Ga0395901_0019368 3300038443 Bacteria 6957
94 Ga0436363_1472023 3300039450 Bacteria 1148
95 Ga0451577_0084889 3300042876 Unclassified 2825
96 Ga0451577_0313311 3300042876 Bacteria 1422
97 Ga0451577_0326591 3300042876 Bacteria 1391
98 Ga0453683_0126945 3300044673 Bacteria 1606
99 Ga0453684_0000119 3300044712 Bacteria 345920
100 Ga0453684_0001805 3300044712 Bacteria 56745
101 Ga0453684_0044113 3300044712 Bacteria 5975
102 Ga0453684_0076897 3300044712 Bacteria 4188
103 Ga0451576_0091128 3300045051 Bacteria 3171
104 Ga0451576_0203811 3300045051 Bacteria 2066
105 Ga0496104_0019657 3300048907 Bacteria 6185
106 Ga0496105_0097465 3300048908 Bacteria 2429
107 Ga0496107_0070692 3300048910 Bacteria 2535
108 Ga0496115_0016323 3300048918 Bacteria 5651
109 Ga0501067_0000007 3300049583 Bacteria 126276
110 Ga0501067_0001756 3300049583 Bacteria 11915
111 Ga0501068_0021209 3300049584 Bacteria 3793
112 Ga0501069_0014704 3300049585 Bacteria 4186
113 Ga0501070_0000151 3300049586 Bacteria 63686
114 Ga0501073_0000195 3300049589 Bacteria 40113
115 Ga0501073_0020626 3300049589 Bacteria 4752
116 Ga0501073_0112580 3300049589 Bacteria 1888
117 Ga0501074_0008759 3300049590 Bacteria 7333
118 Ga0501074_0052022 3300049590 Bacteria 2957
119 Ga0501077_0010918 3300049593 Bacteria 5661
120 Ga0501080_0012635 3300049742 Bacteria 7743
121 Ga0501081_0053056 3300049743 Bacteria 2799
122 Ga0501083_0001205 3300049744 Bacteria 17507
123 Ga0501083_0135945 3300049744 Bacteria 1611
124 Ga0501083_0235084 3300049744 Bacteria 1193
125 nmdc:mga05p37_165756_c1 3300050507 Bacteria 2697
126 nmdc:mga05p37_525747_c1 3300050507 Bacteria 1352
127 nmdc:mga06r32_256310_c1 3300050510 Bacteria 1737
128 nmdc:mga06r32_78185_c1 3300050510 Bacteria 3215
129 nmdc:mga08y16_7823_c1 3300050511 Bacteria 11195
130 nmdc:mga0a205_1944_c2 3300050515 Bacteria 13561
131 Ga0495595_0121246 3300053084 Bacteria 1274
132 Ga0495619_0119978 3300053085 Bacteria 1803
133 Ga0500566_0005919 3300053094 Bacteria 7272
134 Ga0500654_051514 3300053099 Bacteria 2210
135 Ga0500642_0177433 3300053130 Bacteria 996
136 Ga0500603_000882 3300053150 Bacteria 7142
137 Ga0500622_0025297 3300053156 Bacteria 3137
138 Ga0501084_0002655 3300054114 Bacteria 14408
139 Ga0501082_0002180 3300060353 Bacteria 17178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053130 Ga0500642_0177433 Ga0500642_0177433_30_986 317
2 3300009551 Ga0105238_10315501 Ga0105238_103155012 320
3 3300035692 Ga0373935_0111167 Ga0373935_0111167_439_1557 320
4 3300036401 Ga0373937_0151669 Ga0373937_0151669_12_1085 322
5 3300048907 Ga0496104_0019657 Ga0496104_0019657_4052_5125 322
6 3300048908 Ga0496105_0097465 Ga0496105_0097465_247_1320 322
7 3300048918 Ga0496115_0016323 Ga0496115_0016323_1260_2333 322
8 3300028800 Ga0265338_10242294 Ga0265338_102422942 326
9 3300006847 Ga0075431_100150585 Ga0075431_1001505852 327
10 3300006880 Ga0075429_100041163 Ga0075429_1000411634 327
11 3300050510 nmdc:mga06r32_78185_c1 nmdc:mga06r32_78185_c1_1772_2851 327
12 3300013296 Ga0157374_10179214 Ga0157374_101792141 330
13 3300014968 Ga0157379_10103450 Ga0157379_101034503 330
14 3300031238 Ga0265332_10021933 Ga0265332_100219332 330
15 3300048910 Ga0496107_0070692 Ga0496107_0070692_1407_2480 330
16 3300049584 Ga0501068_0021209 Ga0501068_0021209_2374_3456 330
17 3300049586 Ga0501070_0000151 Ga0501070_0000151_5451_6533 330
18 3300049589 Ga0501073_0020626 Ga0501073_0020626_88_1170 330
19 3300049590 Ga0501074_0008759 Ga0501074_0008759_3216_4298 330
20 3300049742 Ga0501080_0012635 Ga0501080_0012635_1261_2343 330
21 3300049743 Ga0501081_0053056 Ga0501081_0053056_447_1529 330
22 3300049744 Ga0501083_0001205 Ga0501083_0001205_13816_14898 330
23 3300060353 Ga0501082_0002180 Ga0501082_0002180_7949_9031 330
24 3300031235 Ga0265330_10025301 Ga0265330_100253013 332
25 3300049585 Ga0501069_0014704 Ga0501069_0014704_980_2065 332
26 3300049590 Ga0501074_0052022 Ga0501074_0052022_962_2044 332
27 3300035118 Ga0373954_0005670 Ga0373954_0005670_2047_3120 333
28 3300035118 Ga0373954_0054293 Ga0373954_0054293_348_1421 333
29 3300035172 Ga0373955_0011373 Ga0373955_0011373_2522_3595 333
30 3300035724 Ga0373933_0008701 Ga0373933_0008701_3030_4103 333
31 3300036401 Ga0373937_0010515 Ga0373937_0010515_3132_4205 333
32 3300036401 Ga0373937_0055606 Ga0373937_0055606_2345_3418 333
33 3300053084 Ga0495595_0121246 Ga0495595_0121246_62_1135 333
34 3300053085 Ga0495619_0119978 Ga0495619_0119978_362_1435 333
35 3300005340 Ga0070689_100000004 Ga0070689_100000004256 334
36 3300006852 Ga0075433_10067079 Ga0075433_100670792 334
37 3300009147 Ga0114129_10006346 Ga0114129_100063464 334
38 3300025936 Ga0207670_10000007 Ga0207670_10000007216 334
39 3300050507 nmdc:mga05p37_165756_c1 nmdc:mga05p37_165756_c1_367_1476 334
40 3300050515 nmdc:mga0a205_1944_c2 nmdc:mga0a205_1944_c2_2960_4069 334
41 3300005331 Ga0070670_100081531 Ga0070670_1000815311 336
42 3300031727 Ga0316576_10075235 Ga0316576_100752352 336
43 3300007265 Ga0099794_10014212 Ga0099794_100142123 337
44 3300039450 Ga0436363_1472023 Ga0436363_1472023_103_1137 338
45 3300037312 Ga0395899_0004859 Ga0395899_0004859_2171_3244 340
46 3300037418 Ga0395900_0044586 Ga0395900_0044586_3109_4182 340
47 3300038443 Ga0395901_0019368 Ga0395901_0019368_4829_5902 340
48 3300049589 Ga0501073_0112580 Ga0501073_0112580_404_1477 340
49 3300050507 nmdc:mga05p37_525747_c1 nmdc:mga05p37_525747_c1_12_1088 340
50 3300054114 Ga0501084_0002655 Ga0501084_0002655_7190_8263 340
51 3300005329 Ga0070683_100104415 Ga0070683_1001044153 341
52 3300005843 Ga0068860_100002508 Ga0068860_10000250813 341
53 3300005844 Ga0068862_100199897 Ga0068862_1001998972 341
54 3300006028 Ga0070717_10237745 Ga0070717_102377451 341
55 3300006844 Ga0075428_100156098 Ga0075428_1001560982 341
56 3300006847 Ga0075431_100252972 Ga0075431_1002529722 341
57 3300009553 Ga0105249_10324474 Ga0105249_103244742 341
58 3300013297 Ga0157378_10064207 Ga0157378_100642073 341
59 3300025944 Ga0207661_10008273 Ga0207661_100082738 341
60 3300025972 Ga0207668_10044947 Ga0207668_100449472 341
61 3300026095 Ga0207676_10258202 Ga0207676_102582022 341
62 3300028786 Ga0307517_10009080 Ga0307517_100090808 341
63 3300031456 Ga0307513_10011656 Ga0307513_100116564 341
64 3300031507 Ga0307509_10000010 Ga0307509_10000010197 341
65 3300031616 Ga0307508_10080551 Ga0307508_100805512 341
66 3300033179 Ga0307507_10043198 Ga0307507_100431983 341
67 3300035113 Ga0373936_0000002 Ga0373936_0000002_130292_131371 341
68 3300035241 Ga0373961_0000073 Ga0373961_0000073_39899_40978 341
69 3300042876 Ga0451577_0313311 Ga0451577_0313311_153_1229 341
70 3300049583 Ga0501067_0001756 Ga0501067_0001756_932_2035 341
71 3300050510 nmdc:mga06r32_256310_c1 nmdc:mga06r32_256310_c1_141_1217 341
72 3300053094 Ga0500566_0005919 Ga0500566_0005919_1264_2343 341
73 3300053099 Ga0500654_051514 Ga0500654_051514_22_1053 341
74 3300053150 Ga0500603_000882 Ga0500603_000882_1484_2563 341
75 3300053156 Ga0500622_0025297 Ga0500622_0025297_1135_2166 341
76 3300025912 Ga0207707_10231542 Ga0207707_102315422 342
77 3300031727 Ga0316576_10041036 Ga0316576_100410362 342
78 3300034818 Ga0373950_0000014 Ga0373950_0000014_96653_97726 342
79 3300049583 Ga0501067_0000007 Ga0501067_0000007_110829_111902 342
80 3300049589 Ga0501073_0000195 Ga0501073_0000195_5952_7025 342
81 3300049593 Ga0501077_0010918 Ga0501077_0010918_325_1389 342
82 3300049744 Ga0501083_0135945 Ga0501083_0135945_328_1407 342
83 3300028558 Ga0265326_10002115 Ga0265326_100021158 343
84 3300028573 Ga0265334_10003931 Ga0265334_100039313 343
85 3300028800 Ga0265338_10073776 Ga0265338_100737762 343
86 3300031235 Ga0265330_10000336 Ga0265330_100003368 343
87 3300031242 Ga0265329_10003257 Ga0265329_100032572 343
88 3300031344 Ga0265316_10000565 Ga0265316_1000056537 343
89 3300031344 Ga0265316_10215769 Ga0265316_102157692 343
90 3300031711 Ga0265314_10008840 Ga0265314_100088405 343
91 3300049744 Ga0501083_0235084 Ga0501083_0235084_75_1157 343
92 3300005455 Ga0070663_100008109 Ga0070663_1000081094 344
93 3300035398 Ga0316574_0072823 Ga0316574_0072823_383_1462 344
94 3300044712 Ga0453684_0000119 Ga0453684_0000119_199075_200154 344
95 3300005354 Ga0070675_100399024 Ga0070675_1003990241 345
96 3300009094 Ga0111539_10002186 Ga0111539_1000218616 345
97 3300025922 Ga0207646_10123633 Ga0207646_101236331 345
98 3300025926 Ga0207659_10185427 Ga0207659_101854272 345
99 3300025936 Ga0207670_10146013 Ga0207670_101460132 345
100 3300027907 Ga0207428_10048918 Ga0207428_100489183 345
101 3300050511 nmdc:mga08y16_7823_c1 nmdc:mga08y16_7823_c1_318_1400 345
102 3300005331 Ga0070670_100054522 Ga0070670_1000545223 346
103 3300025925 Ga0207650_10011345 Ga0207650_100113452 346
104 3300045051 Ga0451576_0203811 Ga0451576_0203811_798_1895 346
105 3300025940 Ga0207691_10022827 Ga0207691_100228274 347
106 3300044712 Ga0453684_0001805 Ga0453684_0001805_42499_43587 347
107 3300044712 Ga0453684_0044113 Ga0453684_0044113_2907_3995 347
108 3300031712 Ga0265342_10006048 Ga0265342_100060483 348
109 3300042876 Ga0451577_0326591 Ga0451577_0326591_268_1359 348
110 3300044673 Ga0453683_0126945 Ga0453683_0126945_224_1315 348
111 3300005343 Ga0070687_100004913 Ga0070687_1000049135 349
112 3300005365 Ga0070688_100112167 Ga0070688_1001121672 349
113 3300005536 Ga0070697_100030275 Ga0070697_1000302754 349
114 3300005841 Ga0068863_100065820 Ga0068863_1000658202 349
115 3300005842 Ga0068858_100128398 Ga0068858_1001283982 349
116 3300009177 Ga0105248_10234841 Ga0105248_102348411 349
117 3300025918 Ga0207662_10009397 Ga0207662_100093975 349
118 3300025941 Ga0207711_10357817 Ga0207711_103578171 349
119 3300025960 Ga0207651_10057526 Ga0207651_100575262 349
120 3300025960 Ga0207651_10216534 Ga0207651_102165341 349
121 3300026035 Ga0207703_10047002 Ga0207703_100470024 349
122 3300042876 Ga0451577_0084889 Ga0451577_0084889_223_1323 349
123 3300045051 Ga0451576_0091128 Ga0451576_0091128_507_1601 349
124 3300005539 Ga0068853_100010422 Ga0068853_1000104222 350
125 3300026023 Ga0207677_10147161 Ga0207677_101471612 350
126 3300026041 Ga0207639_10002000 Ga0207639_1000200016 350
127 3300035170 Ga0373943_0068696 Ga0373943_0068696_355_1452 350
128 3300035725 Ga0373947_0020794 Ga0373947_0020794_1036_2133 350
129 3300025938 Ga0207704_10231535 Ga0207704_102315351 351
130 3300044712 Ga0453684_0076897 Ga0453684_0076897_1669_2775 351
131 3300005719 Ga0068861_100025083 Ga0068861_1000250833 352
132 3300026118 Ga0207675_100039685 Ga0207675_1000396855 352
133 3300007265 Ga0099794_10007091 Ga0099794_100070912 353
134 3300005617 Ga0068859_100015584 Ga0068859_1000155846 356
135 3300006931 Ga0097620_100015584 Ga0097620_1000155843 356
136 3300009551 Ga0105238_10032673 Ga0105238_100326734 356
137 3300025924 Ga0207694_10067681 Ga0207694_100676811 356
138 3300028381 Ga0268264_10038140 Ga0268264_100381402 358
139 3300003323 rootH1_10125983 rootH1_101259832 363

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13528

Glyco_trans_1_3

Glycosyl transferase family 1

34

359

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yf5-assembly1.cif.gz_A crystal structure of the udpga binding domain of the human phase ii metabolizing enzyme udp-glucuronosyltransferase 2b10 0.6967 186 317
8i0e-assembly1.cif.gz_A sb3gt1 complex with udp 0.692 4 332
7yf5-assembly1.cif.gz_B crystal structure of the udpga binding domain of the human phase ii metabolizing enzyme udp-glucuronosyltransferase 2b10 0.6915 176 317
4whm-assembly1.cif.gz_A crystal structure of udp-glucose: anthocyanidin 3-o-glucosyltransferase in complex with udp 0.6843 4 341
7vm0-assembly1.cif.gz_B crystal structure of yojk from b.subtilis in complex with udp 0.6788 2 342
ID Description Score Start End Superfamily
af_A0A0R0ER06_141_257_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8051 247 318 3.40.50.2000
af_Q2FYL5_179_337_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7789 185 320 3.40.50.2000
af_Q4DG37_299_472_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7766 186 319 3.40.50.2000
af_Q21922_274_446_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7705 186 319 3.40.50.2000
2iyaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.763 183 318 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A4V2AV46-F1-model_v4 deleted 0.9838 89 341
AF-A0A534NPN5-F1-model_v4 Teichoic acid biosynthesis protein 0.9732 120 349
AF-A0A2V9W5V9-F1-model_v4 Teichoic acid biosynthesis protein 0.9596 146 324
AF-A0A3D0NK86-F1-model_v4 Teichoic acid biosynthesis protein 0.9547 79 334
AF-A0A814LK87-F1-model_v4 Uncharacterized protein 0.9497 70 341

Feature Viewer

pLDDT pTM Quality
84.71 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map