F178228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 140 | 115 | 139 | 359 |
Family's Representative Sequence
| Representative Sequence | 3300003791|Ga0055530_10000592|Ga0055530_100005927 |
| Length | 395 |
| Sequence | MSFAHPSPKCKRGCAAGREPYPVAMFLARRQLIASSAALALPACTPPRPAPIGAARAAKCLPIANVSPARVIRTIAGLRPYRPSGFVVRAETLGDKRLVHNYGHGGAGITLSWGTSRLAVDLGLPGHSGPVAVLGSGIVGLTTARLLQEAGFAVTLYAAQLPPHTTSNIAGGQWHPASLYDPDQVTPEWLAQFEAAMDYSWRRFQIMTGEEYGIRWLPTYLQMRDDPAEDPPEPDLSHRYETDTVILGPGAHPFPVARVRRFTTMYAETGHLLRQLIRDVQIAGGKFVIRAFATPAEIAALPETLVFNCTGLGAGKLFGDTQIAPVRGQLAVLLPQPELDYAFAGRMGYMFPRGDGIICGGTFEHGEWDATPDPQVIARIIAKQQAFFAGFRCTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 32 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 43 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 44 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 45 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 48 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 69 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 70 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 71 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 72 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 73 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 74 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 75 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 76 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 77 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 78 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 79 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 80 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 81 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 82 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 83 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 84 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 85 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 86 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 87 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 88 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 89 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 97 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 98 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 99 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 100 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 101 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 102 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 103 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 104 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 106 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 107 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 108 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 109 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 110 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 111 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 112 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 113 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 114 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 115 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0 |
| Isolates | 0.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.71 |
| Nodule | 0 |
| Rhizoplane | 2.86 |
| Rhizosphere | 74.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10022234 | 3300001989 | Bacteria | 2251 |
| 2 | JGI24735J21928_10017973 | 3300002067 | Bacteria | 2184 |
| 3 | JGI25150J39212_1000341 | 3300002774 | Bacteria | 23001 |
| 4 | JGI25153J46596_10000108 | 3300003215 | Bacteria | 94715 |
| 5 | Ga0055526_1015816 | 3300003771 | Bacteria | 3002 |
| 6 | Ga0055537_1002268 | 3300003773 | Bacteria | 6609 |
| 7 | Ga0055530_10000592 | 3300003791 | Bacteria | 31363 |
| 8 | Ga0055530_10001103 | 3300003791 | Bacteria | 21123 |
| 9 | Ga0055530_10007309 | 3300003791 | Bacteria | 4685 |
| 10 | Ga0055540_1004091 | 3300003792 | Bacteria | 6757 |
| 11 | Ga0055531_10000083 | 3300003794 | Bacteria | 102626 |
| 12 | Ga0070658_10134049 | 3300005327 | Bacteria | 2066 |
| 13 | Ga0070683_100137028 | 3300005329 | Bacteria | 2318 |
| 14 | Ga0070683_100146063 | 3300005329 | Bacteria | 2241 |
| 15 | Ga0070666_10064984 | 3300005335 | Bacteria | 2475 |
| 16 | Ga0070680_100001883 | 3300005336 | Bacteria | 15391 |
| 17 | Ga0070675_100101430 | 3300005354 | Bacteria | 2425 |
| 18 | Ga0070659_100101474 | 3300005366 | Bacteria | 2316 |
| 19 | Ga0070667_100059470 | 3300005367 | Bacteria | 3233 |
| 20 | Ga0070713_100012625 | 3300005436 | Bacteria | 6206 |
| 21 | Ga0070708_100309139 | 3300005445 | Bacteria | 1489 |
| 22 | Ga0070663_100004655 | 3300005455 | Bacteria | 8084 |
| 23 | Ga0070678_100198006 | 3300005456 | Bacteria | 1656 |
| 24 | Ga0070699_100042464 | 3300005518 | Bacteria | 3935 |
| 25 | Ga0068853_100007565 | 3300005539 | Bacteria | 8698 |
| 26 | Ga0068853_100189428 | 3300005539 | Bacteria | 1868 |
| 27 | Ga0070696_100000196 | 3300005546 | Bacteria | 35612 |
| 28 | Ga0070693_100151608 | 3300005547 | Bacteria | 1469 |
| 29 | Ga0068855_100145116 | 3300005563 | Bacteria | 2703 |
| 30 | Ga0068856_100004586 | 3300005614 | Bacteria | 13740 |
| 31 | Ga0081455_10017668 | 3300005937 | Bacteria | 6825 |
| 32 | Ga0081539_10016203 | 3300005985 | Bacteria | 5344 |
| 33 | Ga0068871_100041064 | 3300006358 | Unclassified | 3707 |
| 34 | Ga0075428_100171470 | 3300006844 | Unclassified | 2351 |
| 35 | Ga0075433_10035473 | 3300006852 | Bacteria | 4289 |
| 36 | Ga0105240_10004548 | 3300009093 | Bacteria | 21057 |
| 37 | Ga0105240_10138385 | 3300009093 | Bacteria | 2913 |
| 38 | Ga0111539_10098862 | 3300009094 | Bacteria | 3427 |
| 39 | Ga0114129_10081376 | 3300009147 | Bacteria | 4501 |
| 40 | Ga0105241_10252240 | 3300009174 | Unclassified | 1496 |
| 41 | Ga0105248_10193776 | 3300009177 | Unclassified | 2290 |
| 42 | Ga0105239_10039357 | 3300010375 | Bacteria | 5181 |
| 43 | Ga0157371_10156515 | 3300013102 | Bacteria | 1626 |
| 44 | Ga0157378_10116685 | 3300013297 | Unclassified | 2455 |
| 45 | Ga0163163_10016009 | 3300014325 | Bacteria | 6952 |
| 46 | Ga0207425_1000098 | 3300025245 | Bacteria | 83892 |
| 47 | Ga0209129_1004069 | 3300025258 | Bacteria | 5959 |
| 48 | Ga0209565_1000214 | 3300025263 | Bacteria | 66404 |
| 49 | Ga0209676_1008376 | 3300025292 | Bacteria | 4622 |
| 50 | Ga0209025_1000413 | 3300025294 | Bacteria | 85984 |
| 51 | Ga0209564_1000887 | 3300025295 | Bacteria | 39501 |
| 52 | Ga0209564_1023869 | 3300025295 | Bacteria | 2108 |
| 53 | Ga0209758_1000019 | 3300025297 | Bacteria | 743682 |
| 54 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 55 | Ga0209050_1000051 | 3300025298 | Bacteria | 353153 |
| 56 | Ga0209050_1005026 | 3300025298 | Bacteria | 8583 |
| 57 | Ga0209050_1010939 | 3300025298 | Bacteria | 4385 |
| 58 | Ga0209051_1000739 | 3300025303 | Bacteria | 35266 |
| 59 | Ga0209257_1000028 | 3300025304 | Bacteria | 699493 |
| 60 | Ga0209257_1001016 | 3300025304 | Bacteria | 37745 |
| 61 | Ga0209257_1001081 | 3300025304 | Bacteria | 35775 |
| 62 | Ga0209257_1003544 | 3300025304 | Bacteria | 13264 |
| 63 | Ga0207680_10045886 | 3300025903 | Bacteria | 2580 |
| 64 | Ga0207647_10103612 | 3300025904 | Bacteria | 1687 |
| 65 | Ga0207654_10106595 | 3300025911 | Unclassified | 1736 |
| 66 | Ga0207707_10184731 | 3300025912 | Bacteria | 1820 |
| 67 | Ga0207695_10007287 | 3300025913 | Bacteria | 14124 |
| 68 | Ga0207660_10001121 | 3300025917 | Bacteria | 17919 |
| 69 | Ga0207660_10110010 | 3300025917 | Bacteria | 2072 |
| 70 | Ga0207657_10092568 | 3300025919 | Bacteria | 2519 |
| 71 | Ga0207700_10042218 | 3300025928 | Bacteria | 3342 |
| 72 | Ga0207661_10021720 | 3300025944 | Bacteria | 4814 |
| 73 | Ga0207679_10121296 | 3300025945 | Bacteria | 2082 |
| 74 | Ga0207667_10084231 | 3300025949 | Bacteria | 3291 |
| 75 | Ga0207667_10103262 | 3300025949 | Bacteria | 2940 |
| 76 | Ga0207640_10081906 | 3300025981 | Bacteria | 2208 |
| 77 | Ga0207639_10025765 | 3300026041 | Bacteria | 4266 |
| 78 | Ga0207639_10092983 | 3300026041 | Bacteria | 2417 |
| 79 | Ga0207678_10007026 | 3300026067 | Bacteria | 9997 |
| 80 | Ga0207678_10233160 | 3300026067 | Bacteria | 1576 |
| 81 | Ga0207702_10262057 | 3300026078 | Unclassified | 1628 |
| 82 | Ga0207674_10007562 | 3300026116 | Bacteria | 12657 |
| 83 | Ga0207674_10014048 | 3300026116 | Bacteria | 8848 |
| 84 | Ga0265338_10117884 | 3300028800 | Bacteria | 2123 |
| 85 | Ga0307408_100101434 | 3300031548 | Bacteria | 2194 |
| 86 | Ga0307412_10004986 | 3300031911 | Bacteria | 7421 |
| 87 | Ga0373953_0068493 | 3300035117 | Bacteria | 1461 |
| 88 | Ga0373943_0124572 | 3300035170 | Bacteria | 1373 |
| 89 | Ga0373955_0027592 | 3300035172 | Bacteria | 2937 |
| 90 | Ga0373924_0066614 | 3300035410 | Bacteria | 1514 |
| 91 | Ga0373935_0004387 | 3300035692 | Bacteria | 8284 |
| 92 | Ga0373935_0018957 | 3300035692 | Bacteria | 4194 |
| 93 | Ga0373947_0025800 | 3300035725 | Bacteria | 3428 |
| 94 | Ga0373925_0006579 | 3300037068 | Bacteria | 8537 |
| 95 | Ga0395900_0009822 | 3300037418 | Bacteria | 9803 |
| 96 | Ga0395900_0040759 | 3300037418 | Bacteria | 4786 |
| 97 | Ga0395905_0115439 | 3300037471 | Bacteria | 2523 |
| 98 | Ga0395901_0000041 | 3300038443 | Bacteria | 202314 |
| 99 | Ga0439448_0001896 | 3300042005 | Bacteria | 5568 |
| 100 | Ga0439458_0000089 | 3300042157 | Bacteria | 17399 |
| 101 | Ga0466969_0024512 | 3300044656 | Bacteria | 3103 |
| 102 | Ga0466966_0070826 | 3300044684 | Bacteria | 2185 |
| 103 | Ga0466963_0000058 | 3300044694 | Bacteria | 37428 |
| 104 | Ga0466963_0028930 | 3300044694 | Bacteria | 3562 |
| 105 | Ga0466957_0012789 | 3300044842 | Bacteria | 4863 |
| 106 | Ga0451576_0717607 | 3300045051 | Bacteria | 1050 |
| 107 | Ga0466967_0001381 | 3300045976 | Bacteria | 14000 |
| 108 | Ga0466967_0002974 | 3300045976 | Bacteria | 10843 |
| 109 | Ga0466967_0087942 | 3300045976 | Bacteria | 2818 |
| 110 | Ga0466967_0201482 | 3300045976 | Bacteria | 1885 |
| 111 | Ga0495580_0123383 | 3300046472 | Bacteria | 1798 |
| 112 | Ga0495586_0158647 | 3300046535 | Bacteria | 1275 |
| 113 | Ga0495645_0031124 | 3300046543 | Bacteria | 3887 |
| 114 | Ga0495635_0171328 | 3300046663 | Bacteria | 1476 |
| 115 | Ga0495647_0005345 | 3300046681 | Bacteria | 4206 |
| 116 | Ga0495647_0034929 | 3300046681 | Bacteria | 1886 |
| 117 | Ga0495669_0076713 | 3300046684 | Unclassified | 1530 |
| 118 | Ga0495684_0023632 | 3300047471 | Bacteria | 4727 |
| 119 | Ga0496111_0078468 | 3300048914 | Bacteria | 2408 |
| 120 | Ga0496112_0180666 | 3300048915 | Bacteria | 2074 |
| 121 | Ga0496114_0000060 | 3300048917 | Bacteria | 90143 |
| 122 | Ga0496114_0153606 | 3300048917 | Bacteria | 1998 |
| 123 | Ga0496122_0001683 | 3300048925 | Bacteria | 34269 |
| 124 | Ga0496123_0006206 | 3300048926 | Bacteria | 11665 |
| 125 | Ga0496124_0016409 | 3300048927 | Bacteria | 7042 |
| 126 | Ga0501042_0208930 | 3300049578 | Unclassified | 1408 |
| 127 | Ga0501075_0235125 | 3300049591 | Unclassified | 1397 |
| 128 | Ga0501076_0133232 | 3300049592 | Unclassified | 2016 |
| 129 | Ga0501227_002942 | 3300049665 | Bacteria | 3723 |
| 130 | Ga0501081_0093416 | 3300049743 | Unclassified | 2118 |
| 131 | Ga0501045_0238775 | 3300049824 | Bacteria | 1353 |
| 132 | nmdc:mga00v17_40669_c1 | 3300050491 | Bacteria | 2789 |
| 133 | nmdc:mga05p37_234361_c1 | 3300050507 | Archaea | 2210 |
| 134 | nmdc:mga08y16_83541_c1 | 3300050511 | Bacteria | 3328 |
| 135 | nmdc:mga0n895_161367_c1 | 3300050512 | Bacteria | 2273 |
| 136 | nmdc:mga0a205_95064_c1 | 3300050515 | Unclassified | 2879 |
| 137 | Ga0500643_018677 | 3300053087 | Bacteria | 2296 |
| 138 | Ga0500658_0002084 | 3300053134 | Bacteria | 7782 |
| 139 | Ga0466962_0056428 | 3300061719 | Bacteria | 1876 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035170 | Ga0373943_0124572 | Ga0373943_0124572_78_893 | 257 |
| 2 | 3300045051 | Ga0451576_0717607 | Ga0451576_0717607_152_994 | 270 |
| 3 | 3300006844 | Ga0075428_100171470 | Ga0075428_1001714703 | 284 |
| 4 | 3300014325 | Ga0163163_10016009 | Ga0163163_100160095 | 297 |
| 5 | 3300035410 | Ga0373924_0066614 | Ga0373924_0066614_139_1092 | 303 |
| 6 | 3300035692 | Ga0373935_0018957 | Ga0373935_0018957_1380_2333 | 303 |
| 7 | 3300046681 | Ga0495647_0005345 | Ga0495647_0005345_1969_2922 | 303 |
| 8 | 3300037418 | Ga0395900_0040759 | Ga0395900_0040759_1838_2923 | 305 |
| 9 | 3300038443 | Ga0395901_0000041 | Ga0395901_0000041_3130_4215 | 305 |
| 10 | 3300005547 | Ga0070693_100151608 | Ga0070693_1001516081 | 312 |
| 11 | 3300010375 | Ga0105239_10039357 | Ga0105239_100393572 | 312 |
| 12 | 3300035172 | Ga0373955_0027592 | Ga0373955_0027592_372_1361 | 315 |
| 13 | 3300035725 | Ga0373947_0025800 | Ga0373947_0025800_750_1739 | 315 |
| 14 | 3300037068 | Ga0373925_0006579 | Ga0373925_0006579_4560_5549 | 315 |
| 15 | 3300037418 | Ga0395900_0009822 | Ga0395900_0009822_12_959 | 315 |
| 16 | 3300046472 | Ga0495580_0123383 | Ga0495580_0123383_181_1170 | 315 |
| 17 | 3300046535 | Ga0495586_0158647 | Ga0495586_0158647_226_1215 | 315 |
| 18 | 3300009174 | Ga0105241_10252240 | Ga0105241_102522402 | 323 |
| 19 | 3300046684 | Ga0495669_0076713 | Ga0495669_0076713_11_997 | 323 |
| 20 | 3300031548 | Ga0307408_100101434 | Ga0307408_1001014342 | 324 |
| 21 | 3300048917 | Ga0496114_0153606 | Ga0496114_0153606_831_1841 | 325 |
| 22 | 3300044656 | Ga0466969_0024512 | Ga0466969_0024512_2035_3015 | 326 |
| 23 | 3300044694 | Ga0466963_0028930 | Ga0466963_0028930_2262_3275 | 326 |
| 24 | 3300005367 | Ga0070667_100059470 | Ga0070667_1000594703 | 331 |
| 25 | 3300026116 | Ga0207674_10014048 | Ga0207674_100140485 | 331 |
| 26 | 3300005335 | Ga0070666_10064984 | Ga0070666_100649842 | 332 |
| 27 | 3300005354 | Ga0070675_100101430 | Ga0070675_1001014302 | 332 |
| 28 | 3300006358 | Ga0068871_100041064 | Ga0068871_1000410641 | 332 |
| 29 | 3300009177 | Ga0105248_10193776 | Ga0105248_101937762 | 332 |
| 30 | 3300025903 | Ga0207680_10045886 | Ga0207680_100458862 | 332 |
| 31 | 3300045976 | Ga0466967_0002974 | Ga0466967_0002974_679_1722 | 338 |
| 32 | 3300045976 | Ga0466967_0201482 | Ga0466967_0201482_585_1631 | 339 |
| 33 | 3300049578 | Ga0501042_0208930 | Ga0501042_0208930_109_1203 | 340 |
| 34 | 3300005336 | Ga0070680_100001883 | Ga0070680_1000018835 | 344 |
| 35 | 3300005539 | Ga0068853_100007565 | Ga0068853_1000075654 | 344 |
| 36 | 3300025917 | Ga0207660_10001121 | Ga0207660_100011219 | 344 |
| 37 | 3300026041 | Ga0207639_10025765 | Ga0207639_100257652 | 344 |
| 38 | 3300048914 | Ga0496111_0078468 | Ga0496111_0078468_988_2103 | 344 |
| 39 | 3300048925 | Ga0496122_0001683 | Ga0496122_0001683_23836_24951 | 344 |
| 40 | 3300048926 | Ga0496123_0006206 | Ga0496123_0006206_1885_3000 | 344 |
| 41 | 3300048927 | Ga0496124_0016409 | Ga0496124_0016409_4606_5721 | 344 |
| 42 | 3300005329 | Ga0070683_100146063 | Ga0070683_1001460634 | 345 |
| 43 | 3300025913 | Ga0207695_10007287 | Ga0207695_1000728717 | 345 |
| 44 | 3300005436 | Ga0070713_100012625 | Ga0070713_1000126252 | 347 |
| 45 | 3300025928 | Ga0207700_10042218 | Ga0207700_100422182 | 347 |
| 46 | 3300046543 | Ga0495645_0031124 | Ga0495645_0031124_504_1646 | 347 |
| 47 | 3300025911 | Ga0207654_10106595 | Ga0207654_101065952 | 349 |
| 48 | 3300026078 | Ga0207702_10262057 | Ga0207702_102620572 | 349 |
| 49 | 3300046663 | Ga0495635_0171328 | Ga0495635_0171328_174_1268 | 349 |
| 50 | 3300035117 | Ga0373953_0068493 | Ga0373953_0068493_16_1104 | 350 |
| 51 | 3300049824 | Ga0501045_0238775 | Ga0501045_0238775_40_1155 | 351 |
| 52 | 3300050507 | nmdc:mga05p37_234361_c1 | nmdc:mga05p37_234361_c1_810_1910 | 351 |
| 53 | 3300005445 | Ga0070708_100309139 | Ga0070708_1003091391 | 352 |
| 54 | 3300006852 | Ga0075433_10035473 | Ga0075433_100354733 | 353 |
| 55 | 3300009093 | Ga0105240_10004548 | Ga0105240_1000454816 | 353 |
| 56 | 3300050515 | nmdc:mga0a205_95064_c1 | nmdc:mga0a205_95064_c1_1600_2715 | 353 |
| 57 | 3300005937 | Ga0081455_10017668 | Ga0081455_100176682 | 354 |
| 58 | 3300009094 | Ga0111539_10098862 | Ga0111539_100988622 | 354 |
| 59 | 3300009147 | Ga0114129_10081376 | Ga0114129_100813764 | 354 |
| 60 | 3300049591 | Ga0501075_0235125 | Ga0501075_0235125_227_1354 | 354 |
| 61 | 3300049592 | Ga0501076_0133232 | Ga0501076_0133232_271_1398 | 354 |
| 62 | 3300049743 | Ga0501081_0093416 | Ga0501081_0093416_20_1147 | 354 |
| 63 | 3300050491 | nmdc:mga00v17_40669_c1 | nmdc:mga00v17_40669_c1_61_1188 | 354 |
| 64 | 3300050511 | nmdc:mga08y16_83541_c1 | nmdc:mga08y16_83541_c1_697_1827 | 354 |
| 65 | 3300050512 | nmdc:mga0n895_161367_c1 | nmdc:mga0n895_161367_c1_1128_2246 | 354 |
| 66 | 3300003771 | Ga0055526_1015816 | Ga0055526_10158162 | 356 |
| 67 | 3300003773 | Ga0055537_1002268 | Ga0055537_10022687 | 356 |
| 68 | 3300005327 | Ga0070658_10134049 | Ga0070658_101340492 | 356 |
| 69 | 3300005518 | Ga0070699_100042464 | Ga0070699_1000424641 | 356 |
| 70 | 3300005546 | Ga0070696_100000196 | Ga0070696_10000019623 | 356 |
| 71 | 3300005563 | Ga0068855_100145116 | Ga0068855_1001451162 | 356 |
| 72 | 3300005614 | Ga0068856_100004586 | Ga0068856_1000045864 | 356 |
| 73 | 3300025263 | Ga0209565_1000214 | Ga0209565_100021445 | 356 |
| 74 | 3300025295 | Ga0209564_1000887 | Ga0209564_100088711 | 356 |
| 75 | 3300025295 | Ga0209564_1023869 | Ga0209564_10238692 | 356 |
| 76 | 3300025298 | Ga0209050_1005026 | Ga0209050_10050266 | 356 |
| 77 | 3300025912 | Ga0207707_10184731 | Ga0207707_101847312 | 356 |
| 78 | 3300028800 | Ga0265338_10117884 | Ga0265338_101178842 | 356 |
| 79 | iso_pu_bacteria | 2852653556 | 2852655578 | 356 |
| 80 | 3300035692 | Ga0373935_0004387 | Ga0373935_0004387_1994_3172 | 357 |
| 81 | 3300053087 | Ga0500643_018677 | Ga0500643_018677_705_1814 | 357 |
| 82 | 3300002774 | JGI25150J39212_1000341 | JGI25150J39212_100034113 | 358 |
| 83 | 3300003215 | JGI25153J46596_10000108 | JGI25153J46596_1000010853 | 358 |
| 84 | 3300003791 | Ga0055530_10007309 | Ga0055530_100073094 | 358 |
| 85 | 3300003792 | Ga0055540_1004091 | Ga0055540_10040916 | 358 |
| 86 | 3300005456 | Ga0070678_100198006 | Ga0070678_1001980062 | 358 |
| 87 | 3300025245 | Ga0207425_1000098 | Ga0207425_100009854 | 358 |
| 88 | 3300025258 | Ga0209129_1004069 | Ga0209129_10040698 | 358 |
| 89 | 3300025292 | Ga0209676_1008376 | Ga0209676_10083762 | 358 |
| 90 | 3300025294 | Ga0209025_1000413 | Ga0209025_100041356 | 358 |
| 91 | 3300025297 | Ga0209758_1000019 | Ga0209758_100001954 | 358 |
| 92 | 3300025298 | Ga0209050_1000005 | Ga0209050_10000058 | 358 |
| 93 | 3300025298 | Ga0209050_1010939 | Ga0209050_10109392 | 358 |
| 94 | 3300025303 | Ga0209051_1000739 | Ga0209051_100073920 | 358 |
| 95 | 3300025304 | Ga0209257_1001016 | Ga0209257_100101628 | 358 |
| 96 | 3300025304 | Ga0209257_1001081 | Ga0209257_100108127 | 358 |
| 97 | 3300025304 | Ga0209257_1003544 | Ga0209257_10035447 | 358 |
| 98 | 3300031911 | Ga0307412_10004986 | Ga0307412_100049866 | 358 |
| 99 | 3300046681 | Ga0495647_0034929 | Ga0495647_0034929_626_1801 | 358 |
| 100 | 3300047471 | Ga0495684_0023632 | Ga0495684_0023632_1015_2190 | 358 |
| 101 | 3300003791 | Ga0055530_10000592 | Ga0055530_100005927 | 359 |
| 102 | 3300003791 | Ga0055530_10001103 | Ga0055530_1000110311 | 359 |
| 103 | 3300003794 | Ga0055531_10000083 | Ga0055531_1000008374 | 359 |
| 104 | 3300025298 | Ga0209050_1000051 | Ga0209050_1000051336 | 359 |
| 105 | 3300025304 | Ga0209257_1000028 | Ga0209257_100002832 | 359 |
| 106 | 3300048917 | Ga0496114_0000060 | Ga0496114_0000060_32261_33451 | 359 |
| 107 | 3300049665 | Ga0501227_002942 | Ga0501227_002942_1388_2557 | 359 |
| 108 | 3300053134 | Ga0500658_0002084 | Ga0500658_0002084_851_1966 | 359 |
| 109 | 3300044684 | Ga0466966_0070826 | Ga0466966_0070826_865_1971 | 360 |
| 110 | 3300044694 | Ga0466963_0000058 | Ga0466963_0000058_22528_23610 | 360 |
| 111 | 3300044842 | Ga0466957_0012789 | Ga0466957_0012789_212_1294 | 360 |
| 112 | 3300045976 | Ga0466967_0001381 | Ga0466967_0001381_10024_11106 | 360 |
| 113 | 3300001989 | JGI24739J22299_10022234 | JGI24739J22299_100222342 | 361 |
| 114 | 3300002067 | JGI24735J21928_10017973 | JGI24735J21928_100179732 | 361 |
| 115 | 3300005329 | Ga0070683_100137028 | Ga0070683_1001370282 | 361 |
| 116 | 3300005366 | Ga0070659_100101474 | Ga0070659_1001014742 | 361 |
| 117 | 3300005455 | Ga0070663_100004655 | Ga0070663_1000046559 | 361 |
| 118 | 3300005539 | Ga0068853_100189428 | Ga0068853_1001894282 | 361 |
| 119 | 3300005985 | Ga0081539_10016203 | Ga0081539_100162035 | 361 |
| 120 | 3300009093 | Ga0105240_10138385 | Ga0105240_101383851 | 361 |
| 121 | 3300013102 | Ga0157371_10156515 | Ga0157371_101565152 | 361 |
| 122 | 3300013297 | Ga0157378_10116685 | Ga0157378_101166852 | 361 |
| 123 | 3300025904 | Ga0207647_10103612 | Ga0207647_101036122 | 361 |
| 124 | 3300025917 | Ga0207660_10110010 | Ga0207660_101100102 | 361 |
| 125 | 3300025919 | Ga0207657_10092568 | Ga0207657_100925682 | 361 |
| 126 | 3300025944 | Ga0207661_10021720 | Ga0207661_100217202 | 361 |
| 127 | 3300025945 | Ga0207679_10121296 | Ga0207679_101212962 | 361 |
| 128 | 3300025949 | Ga0207667_10084231 | Ga0207667_100842312 | 361 |
| 129 | 3300025949 | Ga0207667_10103262 | Ga0207667_101032623 | 361 |
| 130 | 3300025981 | Ga0207640_10081906 | Ga0207640_100819062 | 361 |
| 131 | 3300026041 | Ga0207639_10092983 | Ga0207639_100929832 | 361 |
| 132 | 3300026067 | Ga0207678_10007026 | Ga0207678_1000702611 | 361 |
| 133 | 3300026067 | Ga0207678_10233160 | Ga0207678_102331601 | 361 |
| 134 | 3300026116 | Ga0207674_10007562 | Ga0207674_100075623 | 361 |
| 135 | 3300037471 | Ga0395905_0115439 | Ga0395905_0115439_686_1771 | 361 |
| 136 | 3300042005 | Ga0439448_0001896 | Ga0439448_0001896_742_1827 | 361 |
| 137 | 3300042157 | Ga0439458_0000089 | Ga0439458_0000089_10287_11372 | 361 |
| 138 | 3300045976 | Ga0466967_0087942 | Ga0466967_0087942_708_1793 | 361 |
| 139 | 3300048915 | Ga0496112_0180666 | Ga0496112_0180666_54_1139 | 361 |
| 140 | 3300061719 | Ga0466962_0056428 | Ga0466962_0056428_193_1278 | 361 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nhs-assembly1.cif.gz_A | an l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide | 0.9778 | 101 | 131 |
| 3nt6-assembly1.cif.gz_B | structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant | 0.9737 | 103 | 132 |
| 3ntd-assembly1.cif.gz_A | structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c531s mutant | 0.9731 | 103 | 132 |
| 2v3b-assembly1.cif.gz_A | crystal structure of the electron transfer complex rubredoxin - rubredoxin reductase from pseudomonas aeruginosa. | 0.9585 | 101 | 132 |
| 7o1k-assembly1.cif.gz_B | structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a, beta-c92a mutant | 0.9541 | 101 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_M9NFH8_1768_1873_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9604 | 102 | 129 | 3.40.50.720 |
| af_L7N688_2_179_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9483 | 101 | 132 | 3.40.50.720 |
| 4b3jB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9472 | 100 | 132 | 3.40.50.720 |
| 1xdwA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9447 | 100 | 129 | 3.40.50.720 |
| 2d5cB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9269 | 100 | 132 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A095ASL5-F1-model_v4 | D-amino-acid oxidase (EC 1.4.3.3) | 0.9934 | 35 | 361 |
GO:0003884
GO:0005737 GO:0019478 GO:0071949 |
| AF-A0A095ASL5-F1-model_v4 | D-amino-acid oxidase (EC 1.4.3.3) | 0.9873 | 35 | 361 |
GO:0003884
GO:0005737 GO:0019478 GO:0071949 |
| AF-A0A6I6MN62-F1-model_v4 | D-amino-acid oxidase (EC 1.4.3.3) | 0.9766 | 29 | 357 |
GO:0003884
GO:0005737 GO:0019478 GO:0071949 |
| AF-A0A4Q2YFF6-F1-model_v4 | D-amino-acid oxidase (EC 1.4.3.3) | 0.9728 | 33 | 358 |
GO:0003884
GO:0005737 GO:0019478 GO:0071949 |
| AF-A0A2T5FXY7-F1-model_v4 | D-amino-acid oxidase (EC 1.4.3.3) | 0.9723 | 29 | 359 |
GO:0003884
GO:0005737 GO:0019478 GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar