F178228

General Info

Members Datasets Scaffolds Average Seq Length
140 115 139 359

Family's Representative Sequence

Representative Sequence 3300003791|Ga0055530_10000592|Ga0055530_100005927
Length 395
Sequence MSFAHPSPKCKRGCAAGREPYPVAMFLARRQLIASSAALALPACTPPRPAPIGAARAAKCLPIANVSPARVIRTIAGLRPYRPSGFVVRAETLGDKRLVHNYGHGGAGITLSWGTSRLAVDLGLPGHSGPVAVLGSGIVGLTTARLLQEAGFAVTLYAAQLPPHTTSNIAGGQWHPASLYDPDQVTPEWLAQFEAAMDYSWRRFQIMTGEEYGIRWLPTYLQMRDDPAEDPPEPDLSHRYETDTVILGPGAHPFPVARVRRFTTMYAETGHLLRQLIRDVQIAGGKFVIRAFATPAEIAALPETLVFNCTGLGAGKLFGDTQIAPVRGQLAVLLPQPELDYAFAGRMGYMFPRGDGIICGGTFEHGEWDATPDPQVIARIIAKQQAFFAGFRCTA

Samples

Sample ID Description Type Environment
1 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
43 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
44 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
82 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
94 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
106 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
107 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
108 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
114 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.71
Nodule 0
Rhizoplane 2.86
Rhizosphere 74.29
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10022234 3300001989 Bacteria 2251
2 JGI24735J21928_10017973 3300002067 Bacteria 2184
3 JGI25150J39212_1000341 3300002774 Bacteria 23001
4 JGI25153J46596_10000108 3300003215 Bacteria 94715
5 Ga0055526_1015816 3300003771 Bacteria 3002
6 Ga0055537_1002268 3300003773 Bacteria 6609
7 Ga0055530_10000592 3300003791 Bacteria 31363
8 Ga0055530_10001103 3300003791 Bacteria 21123
9 Ga0055530_10007309 3300003791 Bacteria 4685
10 Ga0055540_1004091 3300003792 Bacteria 6757
11 Ga0055531_10000083 3300003794 Bacteria 102626
12 Ga0070658_10134049 3300005327 Bacteria 2066
13 Ga0070683_100137028 3300005329 Bacteria 2318
14 Ga0070683_100146063 3300005329 Bacteria 2241
15 Ga0070666_10064984 3300005335 Bacteria 2475
16 Ga0070680_100001883 3300005336 Bacteria 15391
17 Ga0070675_100101430 3300005354 Bacteria 2425
18 Ga0070659_100101474 3300005366 Bacteria 2316
19 Ga0070667_100059470 3300005367 Bacteria 3233
20 Ga0070713_100012625 3300005436 Bacteria 6206
21 Ga0070708_100309139 3300005445 Bacteria 1489
22 Ga0070663_100004655 3300005455 Bacteria 8084
23 Ga0070678_100198006 3300005456 Bacteria 1656
24 Ga0070699_100042464 3300005518 Bacteria 3935
25 Ga0068853_100007565 3300005539 Bacteria 8698
26 Ga0068853_100189428 3300005539 Bacteria 1868
27 Ga0070696_100000196 3300005546 Bacteria 35612
28 Ga0070693_100151608 3300005547 Bacteria 1469
29 Ga0068855_100145116 3300005563 Bacteria 2703
30 Ga0068856_100004586 3300005614 Bacteria 13740
31 Ga0081455_10017668 3300005937 Bacteria 6825
32 Ga0081539_10016203 3300005985 Bacteria 5344
33 Ga0068871_100041064 3300006358 Unclassified 3707
34 Ga0075428_100171470 3300006844 Unclassified 2351
35 Ga0075433_10035473 3300006852 Bacteria 4289
36 Ga0105240_10004548 3300009093 Bacteria 21057
37 Ga0105240_10138385 3300009093 Bacteria 2913
38 Ga0111539_10098862 3300009094 Bacteria 3427
39 Ga0114129_10081376 3300009147 Bacteria 4501
40 Ga0105241_10252240 3300009174 Unclassified 1496
41 Ga0105248_10193776 3300009177 Unclassified 2290
42 Ga0105239_10039357 3300010375 Bacteria 5181
43 Ga0157371_10156515 3300013102 Bacteria 1626
44 Ga0157378_10116685 3300013297 Unclassified 2455
45 Ga0163163_10016009 3300014325 Bacteria 6952
46 Ga0207425_1000098 3300025245 Bacteria 83892
47 Ga0209129_1004069 3300025258 Bacteria 5959
48 Ga0209565_1000214 3300025263 Bacteria 66404
49 Ga0209676_1008376 3300025292 Bacteria 4622
50 Ga0209025_1000413 3300025294 Bacteria 85984
51 Ga0209564_1000887 3300025295 Bacteria 39501
52 Ga0209564_1023869 3300025295 Bacteria 2108
53 Ga0209758_1000019 3300025297 Bacteria 743682
54 Ga0209050_1000005 3300025298 Bacteria 1557793
55 Ga0209050_1000051 3300025298 Bacteria 353153
56 Ga0209050_1005026 3300025298 Bacteria 8583
57 Ga0209050_1010939 3300025298 Bacteria 4385
58 Ga0209051_1000739 3300025303 Bacteria 35266
59 Ga0209257_1000028 3300025304 Bacteria 699493
60 Ga0209257_1001016 3300025304 Bacteria 37745
61 Ga0209257_1001081 3300025304 Bacteria 35775
62 Ga0209257_1003544 3300025304 Bacteria 13264
63 Ga0207680_10045886 3300025903 Bacteria 2580
64 Ga0207647_10103612 3300025904 Bacteria 1687
65 Ga0207654_10106595 3300025911 Unclassified 1736
66 Ga0207707_10184731 3300025912 Bacteria 1820
67 Ga0207695_10007287 3300025913 Bacteria 14124
68 Ga0207660_10001121 3300025917 Bacteria 17919
69 Ga0207660_10110010 3300025917 Bacteria 2072
70 Ga0207657_10092568 3300025919 Bacteria 2519
71 Ga0207700_10042218 3300025928 Bacteria 3342
72 Ga0207661_10021720 3300025944 Bacteria 4814
73 Ga0207679_10121296 3300025945 Bacteria 2082
74 Ga0207667_10084231 3300025949 Bacteria 3291
75 Ga0207667_10103262 3300025949 Bacteria 2940
76 Ga0207640_10081906 3300025981 Bacteria 2208
77 Ga0207639_10025765 3300026041 Bacteria 4266
78 Ga0207639_10092983 3300026041 Bacteria 2417
79 Ga0207678_10007026 3300026067 Bacteria 9997
80 Ga0207678_10233160 3300026067 Bacteria 1576
81 Ga0207702_10262057 3300026078 Unclassified 1628
82 Ga0207674_10007562 3300026116 Bacteria 12657
83 Ga0207674_10014048 3300026116 Bacteria 8848
84 Ga0265338_10117884 3300028800 Bacteria 2123
85 Ga0307408_100101434 3300031548 Bacteria 2194
86 Ga0307412_10004986 3300031911 Bacteria 7421
87 Ga0373953_0068493 3300035117 Bacteria 1461
88 Ga0373943_0124572 3300035170 Bacteria 1373
89 Ga0373955_0027592 3300035172 Bacteria 2937
90 Ga0373924_0066614 3300035410 Bacteria 1514
91 Ga0373935_0004387 3300035692 Bacteria 8284
92 Ga0373935_0018957 3300035692 Bacteria 4194
93 Ga0373947_0025800 3300035725 Bacteria 3428
94 Ga0373925_0006579 3300037068 Bacteria 8537
95 Ga0395900_0009822 3300037418 Bacteria 9803
96 Ga0395900_0040759 3300037418 Bacteria 4786
97 Ga0395905_0115439 3300037471 Bacteria 2523
98 Ga0395901_0000041 3300038443 Bacteria 202314
99 Ga0439448_0001896 3300042005 Bacteria 5568
100 Ga0439458_0000089 3300042157 Bacteria 17399
101 Ga0466969_0024512 3300044656 Bacteria 3103
102 Ga0466966_0070826 3300044684 Bacteria 2185
103 Ga0466963_0000058 3300044694 Bacteria 37428
104 Ga0466963_0028930 3300044694 Bacteria 3562
105 Ga0466957_0012789 3300044842 Bacteria 4863
106 Ga0451576_0717607 3300045051 Bacteria 1050
107 Ga0466967_0001381 3300045976 Bacteria 14000
108 Ga0466967_0002974 3300045976 Bacteria 10843
109 Ga0466967_0087942 3300045976 Bacteria 2818
110 Ga0466967_0201482 3300045976 Bacteria 1885
111 Ga0495580_0123383 3300046472 Bacteria 1798
112 Ga0495586_0158647 3300046535 Bacteria 1275
113 Ga0495645_0031124 3300046543 Bacteria 3887
114 Ga0495635_0171328 3300046663 Bacteria 1476
115 Ga0495647_0005345 3300046681 Bacteria 4206
116 Ga0495647_0034929 3300046681 Bacteria 1886
117 Ga0495669_0076713 3300046684 Unclassified 1530
118 Ga0495684_0023632 3300047471 Bacteria 4727
119 Ga0496111_0078468 3300048914 Bacteria 2408
120 Ga0496112_0180666 3300048915 Bacteria 2074
121 Ga0496114_0000060 3300048917 Bacteria 90143
122 Ga0496114_0153606 3300048917 Bacteria 1998
123 Ga0496122_0001683 3300048925 Bacteria 34269
124 Ga0496123_0006206 3300048926 Bacteria 11665
125 Ga0496124_0016409 3300048927 Bacteria 7042
126 Ga0501042_0208930 3300049578 Unclassified 1408
127 Ga0501075_0235125 3300049591 Unclassified 1397
128 Ga0501076_0133232 3300049592 Unclassified 2016
129 Ga0501227_002942 3300049665 Bacteria 3723
130 Ga0501081_0093416 3300049743 Unclassified 2118
131 Ga0501045_0238775 3300049824 Bacteria 1353
132 nmdc:mga00v17_40669_c1 3300050491 Bacteria 2789
133 nmdc:mga05p37_234361_c1 3300050507 Archaea 2210
134 nmdc:mga08y16_83541_c1 3300050511 Bacteria 3328
135 nmdc:mga0n895_161367_c1 3300050512 Bacteria 2273
136 nmdc:mga0a205_95064_c1 3300050515 Unclassified 2879
137 Ga0500643_018677 3300053087 Bacteria 2296
138 Ga0500658_0002084 3300053134 Bacteria 7782
139 Ga0466962_0056428 3300061719 Bacteria 1876

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0124572 Ga0373943_0124572_78_893 257
2 3300045051 Ga0451576_0717607 Ga0451576_0717607_152_994 270
3 3300006844 Ga0075428_100171470 Ga0075428_1001714703 284
4 3300014325 Ga0163163_10016009 Ga0163163_100160095 297
5 3300035410 Ga0373924_0066614 Ga0373924_0066614_139_1092 303
6 3300035692 Ga0373935_0018957 Ga0373935_0018957_1380_2333 303
7 3300046681 Ga0495647_0005345 Ga0495647_0005345_1969_2922 303
8 3300037418 Ga0395900_0040759 Ga0395900_0040759_1838_2923 305
9 3300038443 Ga0395901_0000041 Ga0395901_0000041_3130_4215 305
10 3300005547 Ga0070693_100151608 Ga0070693_1001516081 312
11 3300010375 Ga0105239_10039357 Ga0105239_100393572 312
12 3300035172 Ga0373955_0027592 Ga0373955_0027592_372_1361 315
13 3300035725 Ga0373947_0025800 Ga0373947_0025800_750_1739 315
14 3300037068 Ga0373925_0006579 Ga0373925_0006579_4560_5549 315
15 3300037418 Ga0395900_0009822 Ga0395900_0009822_12_959 315
16 3300046472 Ga0495580_0123383 Ga0495580_0123383_181_1170 315
17 3300046535 Ga0495586_0158647 Ga0495586_0158647_226_1215 315
18 3300009174 Ga0105241_10252240 Ga0105241_102522402 323
19 3300046684 Ga0495669_0076713 Ga0495669_0076713_11_997 323
20 3300031548 Ga0307408_100101434 Ga0307408_1001014342 324
21 3300048917 Ga0496114_0153606 Ga0496114_0153606_831_1841 325
22 3300044656 Ga0466969_0024512 Ga0466969_0024512_2035_3015 326
23 3300044694 Ga0466963_0028930 Ga0466963_0028930_2262_3275 326
24 3300005367 Ga0070667_100059470 Ga0070667_1000594703 331
25 3300026116 Ga0207674_10014048 Ga0207674_100140485 331
26 3300005335 Ga0070666_10064984 Ga0070666_100649842 332
27 3300005354 Ga0070675_100101430 Ga0070675_1001014302 332
28 3300006358 Ga0068871_100041064 Ga0068871_1000410641 332
29 3300009177 Ga0105248_10193776 Ga0105248_101937762 332
30 3300025903 Ga0207680_10045886 Ga0207680_100458862 332
31 3300045976 Ga0466967_0002974 Ga0466967_0002974_679_1722 338
32 3300045976 Ga0466967_0201482 Ga0466967_0201482_585_1631 339
33 3300049578 Ga0501042_0208930 Ga0501042_0208930_109_1203 340
34 3300005336 Ga0070680_100001883 Ga0070680_1000018835 344
35 3300005539 Ga0068853_100007565 Ga0068853_1000075654 344
36 3300025917 Ga0207660_10001121 Ga0207660_100011219 344
37 3300026041 Ga0207639_10025765 Ga0207639_100257652 344
38 3300048914 Ga0496111_0078468 Ga0496111_0078468_988_2103 344
39 3300048925 Ga0496122_0001683 Ga0496122_0001683_23836_24951 344
40 3300048926 Ga0496123_0006206 Ga0496123_0006206_1885_3000 344
41 3300048927 Ga0496124_0016409 Ga0496124_0016409_4606_5721 344
42 3300005329 Ga0070683_100146063 Ga0070683_1001460634 345
43 3300025913 Ga0207695_10007287 Ga0207695_1000728717 345
44 3300005436 Ga0070713_100012625 Ga0070713_1000126252 347
45 3300025928 Ga0207700_10042218 Ga0207700_100422182 347
46 3300046543 Ga0495645_0031124 Ga0495645_0031124_504_1646 347
47 3300025911 Ga0207654_10106595 Ga0207654_101065952 349
48 3300026078 Ga0207702_10262057 Ga0207702_102620572 349
49 3300046663 Ga0495635_0171328 Ga0495635_0171328_174_1268 349
50 3300035117 Ga0373953_0068493 Ga0373953_0068493_16_1104 350
51 3300049824 Ga0501045_0238775 Ga0501045_0238775_40_1155 351
52 3300050507 nmdc:mga05p37_234361_c1 nmdc:mga05p37_234361_c1_810_1910 351
53 3300005445 Ga0070708_100309139 Ga0070708_1003091391 352
54 3300006852 Ga0075433_10035473 Ga0075433_100354733 353
55 3300009093 Ga0105240_10004548 Ga0105240_1000454816 353
56 3300050515 nmdc:mga0a205_95064_c1 nmdc:mga0a205_95064_c1_1600_2715 353
57 3300005937 Ga0081455_10017668 Ga0081455_100176682 354
58 3300009094 Ga0111539_10098862 Ga0111539_100988622 354
59 3300009147 Ga0114129_10081376 Ga0114129_100813764 354
60 3300049591 Ga0501075_0235125 Ga0501075_0235125_227_1354 354
61 3300049592 Ga0501076_0133232 Ga0501076_0133232_271_1398 354
62 3300049743 Ga0501081_0093416 Ga0501081_0093416_20_1147 354
63 3300050491 nmdc:mga00v17_40669_c1 nmdc:mga00v17_40669_c1_61_1188 354
64 3300050511 nmdc:mga08y16_83541_c1 nmdc:mga08y16_83541_c1_697_1827 354
65 3300050512 nmdc:mga0n895_161367_c1 nmdc:mga0n895_161367_c1_1128_2246 354
66 3300003771 Ga0055526_1015816 Ga0055526_10158162 356
67 3300003773 Ga0055537_1002268 Ga0055537_10022687 356
68 3300005327 Ga0070658_10134049 Ga0070658_101340492 356
69 3300005518 Ga0070699_100042464 Ga0070699_1000424641 356
70 3300005546 Ga0070696_100000196 Ga0070696_10000019623 356
71 3300005563 Ga0068855_100145116 Ga0068855_1001451162 356
72 3300005614 Ga0068856_100004586 Ga0068856_1000045864 356
73 3300025263 Ga0209565_1000214 Ga0209565_100021445 356
74 3300025295 Ga0209564_1000887 Ga0209564_100088711 356
75 3300025295 Ga0209564_1023869 Ga0209564_10238692 356
76 3300025298 Ga0209050_1005026 Ga0209050_10050266 356
77 3300025912 Ga0207707_10184731 Ga0207707_101847312 356
78 3300028800 Ga0265338_10117884 Ga0265338_101178842 356
79 iso_pu_bacteria 2852653556 2852655578 356
80 3300035692 Ga0373935_0004387 Ga0373935_0004387_1994_3172 357
81 3300053087 Ga0500643_018677 Ga0500643_018677_705_1814 357
82 3300002774 JGI25150J39212_1000341 JGI25150J39212_100034113 358
83 3300003215 JGI25153J46596_10000108 JGI25153J46596_1000010853 358
84 3300003791 Ga0055530_10007309 Ga0055530_100073094 358
85 3300003792 Ga0055540_1004091 Ga0055540_10040916 358
86 3300005456 Ga0070678_100198006 Ga0070678_1001980062 358
87 3300025245 Ga0207425_1000098 Ga0207425_100009854 358
88 3300025258 Ga0209129_1004069 Ga0209129_10040698 358
89 3300025292 Ga0209676_1008376 Ga0209676_10083762 358
90 3300025294 Ga0209025_1000413 Ga0209025_100041356 358
91 3300025297 Ga0209758_1000019 Ga0209758_100001954 358
92 3300025298 Ga0209050_1000005 Ga0209050_10000058 358
93 3300025298 Ga0209050_1010939 Ga0209050_10109392 358
94 3300025303 Ga0209051_1000739 Ga0209051_100073920 358
95 3300025304 Ga0209257_1001016 Ga0209257_100101628 358
96 3300025304 Ga0209257_1001081 Ga0209257_100108127 358
97 3300025304 Ga0209257_1003544 Ga0209257_10035447 358
98 3300031911 Ga0307412_10004986 Ga0307412_100049866 358
99 3300046681 Ga0495647_0034929 Ga0495647_0034929_626_1801 358
100 3300047471 Ga0495684_0023632 Ga0495684_0023632_1015_2190 358
101 3300003791 Ga0055530_10000592 Ga0055530_100005927 359
102 3300003791 Ga0055530_10001103 Ga0055530_1000110311 359
103 3300003794 Ga0055531_10000083 Ga0055531_1000008374 359
104 3300025298 Ga0209050_1000051 Ga0209050_1000051336 359
105 3300025304 Ga0209257_1000028 Ga0209257_100002832 359
106 3300048917 Ga0496114_0000060 Ga0496114_0000060_32261_33451 359
107 3300049665 Ga0501227_002942 Ga0501227_002942_1388_2557 359
108 3300053134 Ga0500658_0002084 Ga0500658_0002084_851_1966 359
109 3300044684 Ga0466966_0070826 Ga0466966_0070826_865_1971 360
110 3300044694 Ga0466963_0000058 Ga0466963_0000058_22528_23610 360
111 3300044842 Ga0466957_0012789 Ga0466957_0012789_212_1294 360
112 3300045976 Ga0466967_0001381 Ga0466967_0001381_10024_11106 360
113 3300001989 JGI24739J22299_10022234 JGI24739J22299_100222342 361
114 3300002067 JGI24735J21928_10017973 JGI24735J21928_100179732 361
115 3300005329 Ga0070683_100137028 Ga0070683_1001370282 361
116 3300005366 Ga0070659_100101474 Ga0070659_1001014742 361
117 3300005455 Ga0070663_100004655 Ga0070663_1000046559 361
118 3300005539 Ga0068853_100189428 Ga0068853_1001894282 361
119 3300005985 Ga0081539_10016203 Ga0081539_100162035 361
120 3300009093 Ga0105240_10138385 Ga0105240_101383851 361
121 3300013102 Ga0157371_10156515 Ga0157371_101565152 361
122 3300013297 Ga0157378_10116685 Ga0157378_101166852 361
123 3300025904 Ga0207647_10103612 Ga0207647_101036122 361
124 3300025917 Ga0207660_10110010 Ga0207660_101100102 361
125 3300025919 Ga0207657_10092568 Ga0207657_100925682 361
126 3300025944 Ga0207661_10021720 Ga0207661_100217202 361
127 3300025945 Ga0207679_10121296 Ga0207679_101212962 361
128 3300025949 Ga0207667_10084231 Ga0207667_100842312 361
129 3300025949 Ga0207667_10103262 Ga0207667_101032623 361
130 3300025981 Ga0207640_10081906 Ga0207640_100819062 361
131 3300026041 Ga0207639_10092983 Ga0207639_100929832 361
132 3300026067 Ga0207678_10007026 Ga0207678_1000702611 361
133 3300026067 Ga0207678_10233160 Ga0207678_102331601 361
134 3300026116 Ga0207674_10007562 Ga0207674_100075623 361
135 3300037471 Ga0395905_0115439 Ga0395905_0115439_686_1771 361
136 3300042005 Ga0439448_0001896 Ga0439448_0001896_742_1827 361
137 3300042157 Ga0439458_0000089 Ga0439458_0000089_10287_11372 361
138 3300045976 Ga0466967_0087942 Ga0466967_0087942_708_1793 361
139 3300048915 Ga0496112_0180666 Ga0496112_0180666_54_1139 361
140 3300061719 Ga0466962_0056428 Ga0466962_0056428_193_1278 361

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

49

122

0.83

PF01266

DAO

FAD dependent oxidoreductase

130

394

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nhs-assembly1.cif.gz_A an l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide 0.9778 101 131
3nt6-assembly1.cif.gz_B structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant 0.9737 103 132
3ntd-assembly1.cif.gz_A structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c531s mutant 0.9731 103 132
2v3b-assembly1.cif.gz_A crystal structure of the electron transfer complex rubredoxin - rubredoxin reductase from pseudomonas aeruginosa. 0.9585 101 132
7o1k-assembly1.cif.gz_B structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a, beta-c92a mutant 0.9541 101 132
ID Description Score Start End Superfamily
af_M9NFH8_1768_1873_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9604 102 129 3.40.50.720
af_L7N688_2_179_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9483 101 132 3.40.50.720
4b3jB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9472 100 132 3.40.50.720
1xdwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9447 100 129 3.40.50.720
2d5cB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9269 100 132 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A095ASL5-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.9934 35 361 GO:0003884
GO:0005737
GO:0019478
GO:0071949
AF-A0A095ASL5-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.9873 35 361 GO:0003884
GO:0005737
GO:0019478
GO:0071949
AF-A0A6I6MN62-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.9766 29 357 GO:0003884
GO:0005737
GO:0019478
GO:0071949
AF-A0A4Q2YFF6-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.9728 33 358 GO:0003884
GO:0005737
GO:0019478
GO:0071949
AF-A0A2T5FXY7-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.9723 29 359 GO:0003884
GO:0005737
GO:0019478
GO:0071949

Feature Viewer

pLDDT pTM Quality
89.38 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map