F178924

General Info

Members Datasets Scaffolds Average Seq Length
140 113 140 211

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100404447|Ga0070704_1004044471
Length 233
Sequence MFDVAGDVTLLYSTGQPVLMFLVFGVLAGALTGVPIGPVNVAVIDASYRHTMRRAMGVGLGGAIADAFYAGLGIIGVTPVLAKISWMLPILYSVSGVVLLVYGFLTARSQPVTPAVPEEPLSASQAAIIAKRELGEGMKVGVALIILNPAAMVTWVVIIGQLLPTIDNNWEGLACAIGVFAGSFGWFALVAYLTHKGKHVLGDKAAWIPRVVGIALMGYALWLLFKAVKIVIA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
46 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
47 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
48 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
54 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
55 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
67 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
68 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
69 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
70 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
71 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
77 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
78 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
79 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
80 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
81 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
82 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
83 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
84 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
85 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
86 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
87 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
88 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
89 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
90 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
91 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
93 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
94 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
95 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
96 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
97 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
98 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
99 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
100 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
101 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
102 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
103 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
104 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
105 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
106 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
107 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
108 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
109 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
110 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
111 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
112 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.57
Nodule 0
Rhizoplane 1.43
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 8.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10470626 3300005327 Unclassified 1084
2 Ga0070658_10636679 3300005327 Bacteria 925
3 Ga0070690_100002578 3300005330 Bacteria 9754
4 Ga0068869_100082148 3300005334 Bacteria 2408
5 Ga0068868_101021855 3300005338 Unclassified 757
6 Ga0070689_100017000 3300005340 Bacteria 5335
7 Ga0070689_100043096 3300005340 Bacteria 3466
8 Ga0070689_100308827 3300005340 Bacteria 1318
9 Ga0070687_100372364 3300005343 Bacteria 928
10 Ga0070673_100414044 3300005364 Bacteria 1207
11 Ga0070667_100061324 3300005367 Bacteria 3184
12 Ga0070703_10032982 3300005406 Bacteria 1575
13 Ga0070708_100049497 3300005445 Unclassified 3718
14 Ga0070678_100011202 3300005456 Bacteria 5521
15 Ga0070685_10099105 3300005466 Bacteria 1777
16 Ga0070686_100415750 3300005544 Bacteria 1026
17 Ga0070665_100146968 3300005548 Bacteria 2360
18 Ga0070704_100404447 3300005549 Bacteria 1166
19 Ga0068856_100025121 3300005614 Bacteria 5805
20 Ga0068864_100076647 3300005618 Bacteria 2923
21 Ga0068866_10327868 3300005718 Bacteria 965
22 Ga0068861_100203606 3300005719 Bacteria 1663
23 Ga0068863_100211435 3300005841 Bacteria 1868
24 Ga0081455_10027816 3300005937 Bacteria 5177
25 Ga0070717_10005867 3300006028 Bacteria 8993
26 Ga0070717_10014062 3300006028 Bacteria 6152
27 Ga0075429_100016180 3300006880 Bacteria 6464
28 Ga0075429_100065950 3300006880 Bacteria 3152
29 Ga0075429_100109654 3300006880 Bacteria 2413
30 Ga0105245_10034096 3300009098 Bacteria 4513
31 Ga0105247_10524513 3300009101 Bacteria 867
32 Ga0105243_10167039 3300009148 Bacteria 1902
33 Ga0105249_10199140 3300009553 Bacteria 1959
34 Ga0157374_10008992 3300013296 Bacteria 8566
35 Ga0207705_10342560 3300025909 Unclassified 1151
36 Ga0207660_10223961 3300025917 Bacteria 1477
37 Ga0207652_10010830 3300025921 Bacteria 7348
38 Ga0207687_10034286 3300025927 Bacteria 3446
39 Ga0207709_10101610 3300025935 Bacteria 1902
40 Ga0207670_10008672 3300025936 Bacteria 5754
41 Ga0207670_10009544 3300025936 Bacteria 5541
42 Ga0207669_10587958 3300025937 Bacteria 903
43 Ga0207689_10093401 3300025942 Bacteria 2471
44 Ga0207712_10796492 3300025961 Unclassified 830
45 Ga0207708_10233594 3300026075 Unclassified 1477
46 Ga0207702_10119504 3300026078 Unclassified 2356
47 Ga0207641_10570233 3300026088 Bacteria 1105
48 Ga0207676_10063700 3300026095 Bacteria 2929
49 Ga0207683_10012970 3300026121 Bacteria 7115
50 Ga0268266_10004099 3300028379 Bacteria 14071
51 Ga0268264_10159104 3300028381 Bacteria 2033
52 Ga0307517_10068222 3300028786 Bacteria 3243
53 Ga0307515_10018106 3300028794 Bacteria 12781
54 Ga0307513_10002373 3300031456 Bacteria 26137
55 Ga0307509_10000010 3300031507 Bacteria 307427
56 Ga0307509_10025536 3300031507 Bacteria 6594
57 Ga0307509_10064981 3300031507 Bacteria 3835
58 Ga0307509_10102586 3300031507 Bacteria 2892
59 Ga0307509_10417146 3300031507 Bacteria 1044
60 Ga0307508_10055450 3300031616 Bacteria 3511
61 Ga0307516_10043114 3300031730 Bacteria 4472
62 Ga0307516_10136857 3300031730 Bacteria 2223
63 Ga0307405_10045192 3300031731 Bacteria 2697
64 Ga0307406_10039571 3300031901 Unclassified 2926
65 Ga0307415_100026764 3300032126 Bacteria 3644
66 Ga0307415_100989604 3300032126 Bacteria 781
67 Ga0373949_0004919 3300035090 Unclassified 3017
68 Ga0373936_0000002 3300035113 Bacteria 452874
69 Ga0373954_0283761 3300035118 Unclassified 816
70 Ga0373961_0000080 3300035241 Bacteria 51718
71 Ga0395899_0134198 3300037312 Unclassified 1765
72 Ga0395899_0544470 3300037312 Bacteria 747
73 Ga0395900_0089131 3300037418 Bacteria 3171
74 Ga0395905_0094308 3300037471 Bacteria 2808
75 Ga0395905_0702435 3300037471 Bacteria 914
76 Ga0395901_0496095 3300038443 Unclassified 1243
77 Ga0436365_0159706 3300039437 Unclassified 1587
78 Ga0451793_1151127 3300041452 Unclassified 837
79 Ga0453684_0165284 3300044712 Bacteria 2613
80 Ga0466967_0369061 3300045976 Bacteria 1392
81 Ga0495638_0286417 3300046460 Bacteria 893
82 Ga0495632_0244662 3300046519 Bacteria 806
83 Ga0495649_0096649 3300046694 Bacteria 1572
84 Ga0495686_0060505 3300047472 Unclassified 2354
85 Ga0496115_0143757 3300048918 Bacteria 1968
86 Ga0501298_065647 3300049521 Unclassified 775
87 Ga0501034_0279529 3300049571 Bacteria 1609
88 Ga0501036_0561962 3300049572 Unclassified 948
89 Ga0501047_0261970 3300049581 Bacteria 1576
90 Ga0501048_0130357 3300049582 Bacteria 1778
91 Ga0501068_0046028 3300049584 Bacteria 2630
92 Ga0501069_0011747 3300049585 Bacteria 4644
93 Ga0501070_0028515 3300049586 Bacteria 4683
94 Ga0501070_0125369 3300049586 Unclassified 2122
95 Ga0501070_0211532 3300049586 Bacteria 1591
96 Ga0501071_0593511 3300049587 Bacteria 851
97 Ga0501071_0609664 3300049587 Bacteria 839
98 Ga0501072_0384044 3300049588 Bacteria 1114
99 Ga0501073_0078886 3300049589 Unclassified 2292
100 Ga0501074_0295854 3300049590 Bacteria 1150
101 Ga0501216_026438 3300049660 Bacteria 1048
102 Ga0501227_014659 3300049665 Unclassified 1742
103 Ga0501230_055422 3300049667 Unclassified 794
104 Ga0501233_001180 3300049668 Bacteria 4445
105 Ga0501236_013478 3300049670 Unclassified 1119
106 Ga0501225_0004949 3300049705 Unclassified 3937
107 Ga0501229_005890 3300049706 Unclassified 1511
108 Ga0501081_0163486 3300049743 Bacteria 1605
109 Ga0501083_0162351 3300049744 Bacteria 1461
110 Ga0501044_0087224 3300049823 Unclassified 3152
111 nmdc:mga09592_150882_c1 3300050508 Bacteria 2005
112 nmdc:mga09592_3513_c1 3300050508 Bacteria 12666
113 nmdc:mga09592_93508_c1 3300050508 Bacteria 2571
114 Ga0500578_0109627 3300053086 Bacteria 1741
115 Ga0500646_0009141 3300053090 Bacteria 2536
116 Ga0500647_0148586 3300053091 Bacteria 1095
117 Ga0500566_0012614 3300053094 Bacteria 4972
118 Ga0500566_0033224 3300053094 Bacteria 3007
119 Ga0500566_0132933 3300053094 Bacteria 1329
120 Ga0500640_016433 3300053095 Bacteria 3121
121 Ga0500554_001185 3300053102 Bacteria 5060
122 Ga0500562_050602 3300053108 Bacteria 1111
123 Ga0500572_037799 3300053111 Bacteria 1385
124 Ga0500594_0162557 3300053118 Bacteria 722
125 Ga0500595_000155 3300053119 Bacteria 45063
126 Ga0500597_000506 3300053120 Bacteria 8308
127 Ga0500597_107447 3300053120 Bacteria 1212
128 Ga0500608_200480 3300053122 Bacteria 825
129 Ga0500614_003510 3300053123 Bacteria 3372
130 Ga0500614_020713 3300053123 Bacteria 1520
131 Ga0500614_061122 3300053123 Bacteria 1013
132 Ga0500658_0036705 3300053134 Bacteria 1946
133 Ga0500568_0012820 3300053139 Bacteria 3843
134 Ga0500585_079603 3300053144 Unclassified 1184
135 Ga0500603_004292 3300053150 Bacteria 3051
136 Ga0500603_112661 3300053150 Unclassified 818
137 Ga0500638_172503 3300053162 Unclassified 941
138 Ga0500639_032242 3300053163 Bacteria 2771
139 Ga0500639_248920 3300053163 Bacteria 714
140 Ga0501082_0250210 3300060353 Bacteria 1542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006880 Ga0075429_100016180 Ga0075429_1000161806 188
2 3300006880 Ga0075429_100109654 Ga0075429_1001096542 189
3 3300050508 nmdc:mga09592_150882_c1 nmdc:mga09592_150882_c1_504_1136 189
4 3300053139 Ga0500568_0012820 Ga0500568_0012820_191_823 193
5 3300005340 Ga0070689_100043096 Ga0070689_1000430963 194
6 3300025936 Ga0207670_10008672 Ga0207670_100086721 194
7 3300049670 Ga0501236_013478 Ga0501236_013478_243_839 194
8 3300053163 Ga0500639_032242 Ga0500639_032242_1578_2219 199
9 3300005618 Ga0068864_100076647 Ga0068864_1000766472 202
10 3300026095 Ga0207676_10063700 Ga0207676_100637002 202
11 3300005367 Ga0070667_100061324 Ga0070667_1000613244 205
12 3300005334 Ga0068869_100082148 Ga0068869_1000821483 206
13 3300005340 Ga0070689_100017000 Ga0070689_1000170003 206
14 3300005343 Ga0070687_100372364 Ga0070687_1003723641 206
15 3300005406 Ga0070703_10032982 Ga0070703_100329822 206
16 3300005466 Ga0070685_10099105 Ga0070685_100991052 206
17 3300005937 Ga0081455_10027816 Ga0081455_100278167 206
18 3300006028 Ga0070717_10005867 Ga0070717_100058674 206
19 3300025936 Ga0207670_10009544 Ga0207670_100095446 206
20 3300025942 Ga0207689_10093401 Ga0207689_100934013 206
21 3300035113 Ga0373936_0000002 Ga0373936_0000002_86668_87297 206
22 3300044712 Ga0453684_0165284 Ga0453684_0165284_359_1018 206
23 3300031616 Ga0307508_10055450 Ga0307508_100554504 207
24 3300005330 Ga0070690_100002578 Ga0070690_1000025785 208
25 3300005445 Ga0070708_100049497 Ga0070708_1000494972 208
26 3300005544 Ga0070686_100415750 Ga0070686_1004157502 208
27 3300005718 Ga0068866_10327868 Ga0068866_103278682 208
28 3300005841 Ga0068863_100211435 Ga0068863_1002114351 208
29 3300006028 Ga0070717_10014062 Ga0070717_100140628 208
30 3300009098 Ga0105245_10034096 Ga0105245_100340962 208
31 3300009101 Ga0105247_10524513 Ga0105247_105245131 208
32 3300009148 Ga0105243_10167039 Ga0105243_101670392 208
33 3300025927 Ga0207687_10034286 Ga0207687_100342866 208
34 3300025935 Ga0207709_10101610 Ga0207709_101016102 208
35 3300026075 Ga0207708_10233594 Ga0207708_102335942 208
36 3300026088 Ga0207641_10570233 Ga0207641_105702332 208
37 3300028381 Ga0268264_10159104 Ga0268264_101591043 208
38 3300028786 Ga0307517_10068222 Ga0307517_100682223 208
39 3300028794 Ga0307515_10018106 Ga0307515_100181067 208
40 3300031456 Ga0307513_10002373 Ga0307513_1000237314 208
41 3300031507 Ga0307509_10000010 Ga0307509_10000010223 208
42 3300031507 Ga0307509_10025536 Ga0307509_100255363 208
43 3300031507 Ga0307509_10064981 Ga0307509_100649813 208
44 3300031507 Ga0307509_10102586 Ga0307509_101025863 208
45 3300031507 Ga0307509_10417146 Ga0307509_104171462 208
46 3300031730 Ga0307516_10043114 Ga0307516_100431143 208
47 3300031730 Ga0307516_10136857 Ga0307516_101368572 208
48 3300035090 Ga0373949_0004919 Ga0373949_0004919_619_1254 208
49 3300035118 Ga0373954_0283761 Ga0373954_0283761_108_749 208
50 3300035241 Ga0373961_0000080 Ga0373961_0000080_14827_15468 208
51 3300039437 Ga0436365_0159706 Ga0436365_0159706_345_971 208
52 3300041452 Ga0451793_1151127 Ga0451793_1151127_197_823 208
53 3300046460 Ga0495638_0286417 Ga0495638_0286417_84_722 208
54 3300046519 Ga0495632_0244662 Ga0495632_0244662_15_659 208
55 3300046694 Ga0495649_0096649 Ga0495649_0096649_670_1302 208
56 3300053086 Ga0500578_0109627 Ga0500578_0109627_724_1350 208
57 3300053090 Ga0500646_0009141 Ga0500646_0009141_52_681 208
58 3300053091 Ga0500647_0148586 Ga0500647_0148586_289_915 208
59 3300053094 Ga0500566_0012614 Ga0500566_0012614_2464_3102 208
60 3300053094 Ga0500566_0033224 Ga0500566_0033224_1265_1891 208
61 3300053094 Ga0500566_0132933 Ga0500566_0132933_657_1283 208
62 3300053095 Ga0500640_016433 Ga0500640_016433_1141_1779 208
63 3300053102 Ga0500554_001185 Ga0500554_001185_2080_2718 208
64 3300053108 Ga0500562_050602 Ga0500562_050602_432_1061 208
65 3300053111 Ga0500572_037799 Ga0500572_037799_42_680 208
66 3300053118 Ga0500594_0162557 Ga0500594_0162557_61_690 208
67 3300053119 Ga0500595_000155 Ga0500595_000155_33548_34186 208
68 3300053120 Ga0500597_000506 Ga0500597_000506_6882_7517 208
69 3300053120 Ga0500597_107447 Ga0500597_107447_297_935 208
70 3300053122 Ga0500608_200480 Ga0500608_200480_27_665 208
71 3300053123 Ga0500614_003510 Ga0500614_003510_349_987 208
72 3300053123 Ga0500614_020713 Ga0500614_020713_111_746 208
73 3300053123 Ga0500614_061122 Ga0500614_061122_250_876 208
74 3300053134 Ga0500658_0036705 Ga0500658_0036705_1181_1819 208
75 3300053144 Ga0500585_079603 Ga0500585_079603_377_1003 208
76 3300053150 Ga0500603_004292 Ga0500603_004292_448_1074 208
77 3300053150 Ga0500603_112661 Ga0500603_112661_121_756 208
78 3300053162 Ga0500638_172503 Ga0500638_172503_98_733 208
79 3300053163 Ga0500639_248920 Ga0500639_248920_14_640 208
80 3300031731 Ga0307405_10045192 Ga0307405_100451922 209
81 3300032126 Ga0307415_100989604 Ga0307415_1009896041 209
82 3300049584 Ga0501068_0046028 Ga0501068_0046028_918_1556 211
83 3300049585 Ga0501069_0011747 Ga0501069_0011747_2304_2942 211
84 3300049586 Ga0501070_0211532 Ga0501070_0211532_779_1417 211
85 3300049587 Ga0501071_0609664 Ga0501071_0609664_104_742 211
86 3300049588 Ga0501072_0384044 Ga0501072_0384044_336_974 211
87 3300049743 Ga0501081_0163486 Ga0501081_0163486_681_1319 211
88 3300049744 Ga0501083_0162351 Ga0501083_0162351_389_1027 211
89 3300060353 Ga0501082_0250210 Ga0501082_0250210_23_661 211
90 3300005327 Ga0070658_10636679 Ga0070658_106366791 212
91 3300005364 Ga0070673_100414044 Ga0070673_1004140442 212
92 3300005456 Ga0070678_100011202 Ga0070678_1000112028 212
93 3300005548 Ga0070665_100146968 Ga0070665_1001469682 212
94 3300013296 Ga0157374_10008992 Ga0157374_1000899210 212
95 3300025937 Ga0207669_10587958 Ga0207669_105879582 212
96 3300026121 Ga0207683_10012970 Ga0207683_100129705 212
97 3300028379 Ga0268266_10004099 Ga0268266_1000409911 212
98 3300037312 Ga0395899_0134198 Ga0395899_0134198_803_1450 212
99 3300037312 Ga0395899_0544470 Ga0395899_0544470_23_670 212
100 3300037418 Ga0395900_0089131 Ga0395900_0089131_2120_2767 212
101 3300037471 Ga0395905_0702435 Ga0395905_0702435_21_677 212
102 3300038443 Ga0395901_0496095 Ga0395901_0496095_514_1161 212
103 3300048918 Ga0496115_0143757 Ga0496115_0143757_1247_1900 212
104 3300049586 Ga0501070_0028515 Ga0501070_0028515_1117_1767 212
105 3300005327 Ga0070658_10470626 Ga0070658_104706262 213
106 3300005338 Ga0068868_101021855 Ga0068868_1010218551 213
107 3300005340 Ga0070689_100308827 Ga0070689_1003088271 213
108 3300005549 Ga0070704_100404447 Ga0070704_1004044471 213
109 3300005614 Ga0068856_100025121 Ga0068856_1000251214 213
110 3300005719 Ga0068861_100203606 Ga0068861_1002036062 213
111 3300006880 Ga0075429_100065950 Ga0075429_1000659501 213
112 3300009553 Ga0105249_10199140 Ga0105249_101991402 213
113 3300025909 Ga0207705_10342560 Ga0207705_103425602 213
114 3300025917 Ga0207660_10223961 Ga0207660_102239612 213
115 3300025921 Ga0207652_10010830 Ga0207652_100108306 213
116 3300025961 Ga0207712_10796492 Ga0207712_107964921 213
117 3300026078 Ga0207702_10119504 Ga0207702_101195043 213
118 3300031901 Ga0307406_10039571 Ga0307406_100395711 213
119 3300032126 Ga0307415_100026764 Ga0307415_1000267644 213
120 3300037471 Ga0395905_0094308 Ga0395905_0094308_1449_2150 213
121 3300045976 Ga0466967_0369061 Ga0466967_0369061_656_1306 213
122 3300047472 Ga0495686_0060505 Ga0495686_0060505_1323_1967 213
123 3300049521 Ga0501298_065647 Ga0501298_065647_71_724 213
124 3300049571 Ga0501034_0279529 Ga0501034_0279529_24_665 213
125 3300049572 Ga0501036_0561962 Ga0501036_0561962_207_857 213
126 3300049581 Ga0501047_0261970 Ga0501047_0261970_138_779 213
127 3300049582 Ga0501048_0130357 Ga0501048_0130357_899_1549 213
128 3300049586 Ga0501070_0125369 Ga0501070_0125369_929_1579 213
129 3300049587 Ga0501071_0593511 Ga0501071_0593511_20_667 213
130 3300049589 Ga0501073_0078886 Ga0501073_0078886_40_681 213
131 3300049590 Ga0501074_0295854 Ga0501074_0295854_271_912 213
132 3300049660 Ga0501216_026438 Ga0501216_026438_26_670 213
133 3300049665 Ga0501227_014659 Ga0501227_014659_286_939 213
134 3300049667 Ga0501230_055422 Ga0501230_055422_109_762 213
135 3300049668 Ga0501233_001180 Ga0501233_001180_1239_1892 213
136 3300049705 Ga0501225_0004949 Ga0501225_0004949_43_696 213
137 3300049706 Ga0501229_005890 Ga0501229_005890_653_1306 213
138 3300049823 Ga0501044_0087224 Ga0501044_0087224_1784_2434 213
139 3300050508 nmdc:mga09592_3513_c1 nmdc:mga09592_3513_c1_2956_3603 213
140 3300050508 nmdc:mga09592_93508_c1 nmdc:mga09592_93508_c1_89_733 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

30

227

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ahx-assembly1.cif.gz_A cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.456 24 205
7zc6-assembly1.cif.gz_A na+ - translocating ferredoxin: nad+ reductase (rnf) of c. tetanomorphum 0.4555 24 207
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4459 2 210
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4367 2 210
7yuf-assembly1.cif.gz_R apo human spns2 0.4227 2 204
ID Description Score Start End Superfamily
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.531 3 206 1.20.1250.20
af_P0A766_4_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5247 2 207 1.10.1760.20
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5148 5 207 1.20.1250.20
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5112 3 206 1.20.1250.20
af_P0A766_4_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5103 2 207 1.10.1760.20
ID Description Score Start End GO Terms
AF-D0LGC7-F1-model_v4 Lysine exporter protein (LYSE/YGGA) 0.881 2 212 GO:0005886
GO:0015171
AF-Q01YH6-F1-model_v4 Lysine exporter protein (LYSE/YGGA) 0.8607 1 209 GO:0005886
GO:0015171
AF-D0LGC7-F1-model_v4 Lysine exporter protein (LYSE/YGGA) 0.8591 2 212 GO:0005886
GO:0015171
AF-A0A6M2ADV0-F1-model_v4 Uncharacterized protein 0.8508 2 210 GO:0005886
GO:0015171
AF-A0A4R3M4S0-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.8488 2 212 GO:0005886
GO:0015171

Feature Viewer

pLDDT pTM Quality
80.64 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map