F179170

General Info

Members Datasets Scaffolds Average Seq Length
140 101 140 122

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100852944|Ga0097621_1008529441
Length 143
Sequence LIYELRFTNYDFVPDCLILGFNLKQIIMTKEELKQRTKSYALANARLVLSLPYNIVNKNYADQLNRSASSTGANYRAACRAKSKNDFINKLKIVEEELDETLFFLELLIELNPELKEKIDPIYKEGNELLSIIVAALNTLRGN

Samples

Sample ID Description Type Environment
1 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
80 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
101 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.57
Nodule 0
Rhizoplane 0
Rhizosphere 87.86
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000013 3300002774 Bacteria 182307
2 JGI25151J46595_10000004 3300003187 Bacteria 494006
3 JGI25153J46596_10000004 3300003215 Bacteria 494006
4 rootH2_10170922 3300003320 Bacteria 2670
5 rootH1_10014015 3300003323 Bacteria 3581
6 rootH1_10014016 3300003323 Bacteria 2177
7 Ga0065707_10474405 3300005295 Bacteria 778
8 Ga0070660_100142427 3300005339 Bacteria 1924
9 Ga0070689_100012529 3300005340 Bacteria 6111
10 Ga0070668_100467346 3300005347 Bacteria 1087
11 Ga0070675_100296842 3300005354 Unclassified 1423
12 Ga0070675_101405044 3300005354 Bacteria 643
13 Ga0070700_100621363 3300005441 Bacteria 849
14 Ga0068867_100805263 3300005459 Bacteria 838
15 Ga0068867_101225431 3300005459 Bacteria 690
16 Ga0068853_100140439 3300005539 Bacteria 2168
17 Ga0068853_100673978 3300005539 Unclassified 985
18 Ga0070695_100656693 3300005545 Bacteria 828
19 Ga0068855_100001684 3300005563 Bacteria 27684
20 Ga0070664_101418215 3300005564 Unclassified 657
21 Ga0068857_100008886 3300005577 Bacteria 8702
22 Ga0068856_100014628 3300005614 Bacteria 7581
23 Ga0068856_102041265 3300005614 Unclassified 583
24 Ga0068859_102665602 3300005617 Bacteria 549
25 Ga0068864_101030542 3300005618 Bacteria 817
26 Ga0068851_10000105 3300005834 Bacteria 45381
27 Ga0068870_10026050 3300005840 Bacteria 2910
28 Ga0068863_100393668 3300005841 Bacteria 1354
29 Ga0068860_102001016 3300005843 Bacteria 601
30 Ga0097621_100852944 3300006237 Bacteria 846
31 Ga0097621_101338818 3300006237 Bacteria 677
32 Ga0068871_100590819 3300006358 Bacteria 1009
33 Ga0097620_102665661 3300006931 Bacteria 549
34 Ga0105240_10180057 3300009093 Unclassified 2495
35 Ga0105242_10657631 3300009176 Bacteria 1020
36 Ga0105242_10709072 3300009176 Unclassified 985
37 Ga0105242_10962233 3300009176 Unclassified 859
38 Ga0105237_10344904 3300009545 Bacteria 1494
39 Ga0105238_10350475 3300009551 Bacteria 1465
40 Ga0105239_11693610 3300010375 Bacteria 732
41 Ga0157373_10129208 3300013100 Bacteria 1776
42 Ga0157371_10165613 3300013102 Bacteria 1579
43 Ga0157370_10208260 3300013104 Bacteria 1813
44 Ga0157370_11603450 3300013104 Unclassified 585
45 Ga0157374_10726246 3300013296 Bacteria 1007
46 Ga0157374_10803874 3300013296 Bacteria 956
47 Ga0157374_11736135 3300013296 Bacteria 649
48 Ga0157378_10008896 3300013297 Bacteria 8739
49 Ga0163162_10004098 3300013306 Bacteria 13988
50 Ga0163162_10888399 3300013306 Bacteria 1005
51 Ga0163162_13087108 3300013306 Bacteria 535
52 Ga0157372_10030289 3300013307 Bacteria 5919
53 Ga0157372_10287096 3300013307 Unclassified 1913
54 Ga0157372_10618075 3300013307 Bacteria 1263
55 Ga0157372_12544025 3300013307 Bacteria 588
56 Ga0157375_10066420 3300013308 Unclassified 3601
57 Ga0157375_10629014 3300013308 Bacteria 1231
58 Ga0157375_10803574 3300013308 Bacteria 1089
59 Ga0163163_10119275 3300014325 Bacteria 2671
60 Ga0163163_12769238 3300014325 Unclassified 547
61 Ga0163163_13080497 3300014325 Bacteria 520
62 Ga0157380_10034388 3300014326 Bacteria 3909
63 Ga0157377_10000221 3300014745 Bacteria 30126
64 Ga0207427_123801 3300025231 Bacteria 538
65 Ga0207425_1000008 3300025245 Bacteria 618024
66 Ga0209148_1054303 3300025254 Bacteria 505
67 Ga0209129_1000042 3300025258 Bacteria 305537
68 Ga0209233_1001629 3300025261 Bacteria 8736
69 Ga0209025_1000020 3300025294 Bacteria 618024
70 Ga0209758_1000022 3300025297 Bacteria 618024
71 Ga0207656_10000170 3300025321 Bacteria 23964
72 Ga0207645_10492864 3300025907 Unclassified 829
73 Ga0207643_10009730 3300025908 Bacteria 5158
74 Ga0207654_10448183 3300025911 Bacteria 905
75 Ga0207695_10164802 3300025913 Bacteria 2145
76 Ga0207671_10218226 3300025914 Bacteria 1493
77 Ga0207657_10125059 3300025919 Bacteria 2112
78 Ga0207650_10092222 3300025925 Bacteria 2316
79 Ga0207659_10005648 3300025926 Bacteria 7607
80 Ga0207659_11547410 3300025926 Bacteria 567
81 Ga0207644_10556707 3300025931 Unclassified 950
82 Ga0207690_10273105 3300025932 Bacteria 1314
83 Ga0207670_10206699 3300025936 Bacteria 1495
84 Ga0207679_10604239 3300025945 Bacteria 989
85 Ga0207667_10002331 3300025949 Bacteria 23775
86 Ga0207667_10084765 3300025949 Unclassified 3280
87 Ga0207712_10005794 3300025961 Bacteria 7785
88 Ga0207668_10346245 3300025972 Bacteria 1241
89 Ga0207639_10112261 3300026041 Bacteria 2224
90 Ga0207639_10783263 3300026041 Unclassified 888
91 Ga0207639_11828371 3300026041 Bacteria 568
92 Ga0207708_10694081 3300026075 Bacteria 870
93 Ga0207702_10026002 3300026078 Bacteria 4860
94 Ga0207641_10130103 3300026088 Bacteria 2259
95 Ga0207674_10200561 3300026116 Bacteria 1944
96 Ga0207428_10090870 3300027907 Bacteria 2371
97 Ga0268265_10029438 3300028380 Bacteria 3941
98 Ga0307515_10045800 3300028794 Bacteria 6707
99 Ga0265327_10000473 3300031251 Bacteria 70933
100 Ga0265327_10111797 3300031251 Unclassified 1304
101 Ga0265316_10770527 3300031344 Bacteria 676
102 Ga0265313_10150321 3300031595 Unclassified 995
103 Ga0307410_11223731 3300031852 Unclassified 655
104 Ga0307510_10032796 3300033180 Bacteria 5847
105 Ga0373950_0094437 3300034818 Bacteria 638
106 Ga0395899_0002435 3300037312 Bacteria 15139
107 Ga0395900_0000141 3300037418 Bacteria 121159
108 Ga0395900_0166410 3300037418 Bacteria 2247
109 Ga0395898_0012951 3300037466 Bacteria 8602
110 Ga0395898_0290085 3300037466 Bacteria 1561
111 Ga0395905_0000124 3300037471 Bacteria 126707
112 Ga0395905_0000601 3300037471 Bacteria 48125
113 Ga0395905_0416008 3300037471 Bacteria 1240
114 Ga0395905_0703645 3300037471 Unclassified 913
115 Ga0395901_0000138 3300038443 Bacteria 94944
116 Ga0451577_0300225 3300042876 Bacteria 1455
117 Ga0451577_1117092 3300042876 Unclassified 705
118 Ga0451577_1142327 3300042876 Bacteria 696
119 Ga0453684_0009766 3300044712 Bacteria 16663
120 Ga0453684_0035163 3300044712 Bacteria 6931
121 Ga0453684_0278200 3300044712 Bacteria 1910
122 Ga0453684_0565346 3300044712 Unclassified 1251
123 Ga0453684_0644853 3300044712 Unclassified 1156
124 Ga0451576_0007064 3300045051 Bacteria 13567
125 Ga0451576_0374961 3300045051 Bacteria 1491
126 Ga0451576_0385194 3300045051 Unclassified 1470
127 Ga0495651_0111251 3300046462 Bacteria 2025
128 Ga0495596_0167405 3300046500 Bacteria 854
129 Ga0495606_0143208 3300046507 Bacteria 1410
130 Ga0495632_0107076 3300046519 Bacteria 1315
131 Ga0495652_0087808 3300046529 Bacteria 2550
132 Ga0495658_0849122 3300046683 Bacteria 584
133 Ga0495649_0110438 3300046694 Bacteria 1458
134 Ga0495649_0689393 3300046694 Bacteria 501
135 Ga0495600_0607789 3300046809 Bacteria 664
136 Ga0495683_0041993 3300047323 Bacteria 2306
137 Ga0495686_0026358 3300047472 Bacteria 3803
138 Ga0501083_0030606 3300049744 Unclassified 3696
139 Ga0500641_0382615 3300053096 Bacteria 558
140 Ga0500642_0067922 3300053130 Bacteria 1616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005295 Ga0065707_10474405 Ga0065707_104744051 114
2 3300005340 Ga0070689_100012529 Ga0070689_1000125294 114
3 3300005354 Ga0070675_101405044 Ga0070675_1014050441 114
4 3300005577 Ga0068857_100008886 Ga0068857_1000088861 114
5 3300005617 Ga0068859_102665602 Ga0068859_1026656021 114
6 3300005840 Ga0068870_10026050 Ga0068870_100260502 114
7 3300006931 Ga0097620_102665661 Ga0097620_1026656612 114
8 3300013308 Ga0157375_10066420 Ga0157375_100664202 114
9 3300014326 Ga0157380_10034388 Ga0157380_100343883 114
10 3300014745 Ga0157377_10000221 Ga0157377_100002212 114
11 3300025907 Ga0207645_10492864 Ga0207645_104928642 114
12 3300025908 Ga0207643_10009730 Ga0207643_100097302 114
13 3300025925 Ga0207650_10092222 Ga0207650_100922222 114
14 3300025926 Ga0207659_10005648 Ga0207659_100056483 114
15 3300025936 Ga0207670_10206699 Ga0207670_102066992 114
16 3300025961 Ga0207712_10005794 Ga0207712_100057946 114
17 3300025972 Ga0207668_10346245 Ga0207668_103462452 114
18 3300027907 Ga0207428_10090870 Ga0207428_100908702 114
19 3300028380 Ga0268265_10029438 Ga0268265_100294382 114
20 3300005459 Ga0068867_101225431 Ga0068867_1012254312 115
21 3300005843 Ga0068860_102001016 Ga0068860_1020010161 115
22 3300006237 Ga0097621_101338818 Ga0097621_1013388182 115
23 3300006358 Ga0068871_100590819 Ga0068871_1005908192 115
24 3300009176 Ga0105242_10709072 Ga0105242_107090721 115
25 3300013296 Ga0157374_11736135 Ga0157374_117361351 115
26 3300013297 Ga0157378_10008896 Ga0157378_100088965 115
27 3300013306 Ga0163162_10888399 Ga0163162_108883992 115
28 3300013306 Ga0163162_13087108 Ga0163162_130871081 115
29 3300013308 Ga0157375_10629014 Ga0157375_106290142 115
30 3300013308 Ga0157375_10803574 Ga0157375_108035741 115
31 3300005339 Ga0070660_100142427 Ga0070660_1001424272 116
32 3300005539 Ga0068853_100140439 Ga0068853_1001404393 116
33 3300005563 Ga0068855_100001684 Ga0068855_10000168421 116
34 3300005614 Ga0068856_100014628 Ga0068856_1000146284 116
35 3300006237 Ga0097621_100852944 Ga0097621_1008529441 116
36 3300009093 Ga0105240_10180057 Ga0105240_101800571 116
37 3300009545 Ga0105237_10344904 Ga0105237_103449042 116
38 3300009551 Ga0105238_10350475 Ga0105238_103504752 116
39 3300010375 Ga0105239_11693610 Ga0105239_116936101 116
40 3300013104 Ga0157370_10208260 Ga0157370_102082601 116
41 3300013104 Ga0157370_11603450 Ga0157370_116034501 116
42 3300013296 Ga0157374_10803874 Ga0157374_108038741 116
43 3300013306 Ga0163162_10004098 Ga0163162_100040982 116
44 3300025231 Ga0207427_123801 Ga0207427_1238011 116
45 3300025261 Ga0209233_1001629 Ga0209233_100162910 116
46 3300025911 Ga0207654_10448183 Ga0207654_104481832 116
47 3300025913 Ga0207695_10164802 Ga0207695_101648022 116
48 3300025914 Ga0207671_10218226 Ga0207671_102182262 116
49 3300025919 Ga0207657_10125059 Ga0207657_101250594 116
50 3300025949 Ga0207667_10002331 Ga0207667_1000233121 116
51 3300026041 Ga0207639_10112261 Ga0207639_101122613 116
52 3300026078 Ga0207702_10026002 Ga0207702_100260022 116
53 3300028794 Ga0307515_10045800 Ga0307515_100458002 116
54 3300033180 Ga0307510_10032796 Ga0307510_100327962 116
55 3300037418 Ga0395900_0166410 Ga0395900_0166410_401_751 116
56 3300037466 Ga0395898_0290085 Ga0395898_0290085_263_613 116
57 3300037471 Ga0395905_0416008 Ga0395905_0416008_189_539 116
58 3300037471 Ga0395905_0703645 Ga0395905_0703645_486_836 116
59 3300046462 Ga0495651_0111251 Ga0495651_0111251_1592_1942 116
60 3300046500 Ga0495596_0167405 Ga0495596_0167405_440_790 116
61 3300046507 Ga0495606_0143208 Ga0495606_0143208_134_484 116
62 3300046519 Ga0495632_0107076 Ga0495632_0107076_512_862 116
63 3300046529 Ga0495652_0087808 Ga0495652_0087808_1736_2086 116
64 3300046694 Ga0495649_0110438 Ga0495649_0110438_1090_1440 116
65 3300047323 Ga0495683_0041993 Ga0495683_0041993_1425_1775 116
66 3300047472 Ga0495686_0026358 Ga0495686_0026358_3202_3552 116
67 3300053096 Ga0500641_0382615 Ga0500641_0382615_153_503 116
68 3300053130 Ga0500642_0067922 Ga0500642_0067922_284_634 116
69 3300005564 Ga0070664_101418215 Ga0070664_1014182152 117
70 3300009176 Ga0105242_10962233 Ga0105242_109622331 117
71 3300014325 Ga0163163_12769238 Ga0163163_127692381 117
72 3300025931 Ga0207644_10556707 Ga0207644_105567071 117
73 3300037312 Ga0395899_0002435 Ga0395899_0002435_395_748 117
74 3300037418 Ga0395900_0000141 Ga0395900_0000141_78578_78931 117
75 3300037466 Ga0395898_0012951 Ga0395898_0012951_6788_7141 117
76 3300037471 Ga0395905_0000124 Ga0395905_0000124_56724_57077 117
77 3300038443 Ga0395901_0000138 Ga0395901_0000138_82143_82496 117
78 3300046694 Ga0495649_0689393 Ga0495649_0689393_41_394 117
79 3300049744 Ga0501083_0030606 Ga0501083_0030606_2696_3049 117
80 3300005347 Ga0070668_100467346 Ga0070668_1004673461 118
81 3300005441 Ga0070700_100621363 Ga0070700_1006213632 118
82 3300005539 Ga0068853_100673978 Ga0068853_1006739782 118
83 3300005545 Ga0070695_100656693 Ga0070695_1006566931 118
84 3300009176 Ga0105242_10657631 Ga0105242_106576312 118
85 3300014325 Ga0163163_10119275 Ga0163163_101192753 118
86 3300014325 Ga0163163_13080497 Ga0163163_130804971 118
87 3300025945 Ga0207679_10604239 Ga0207679_106042392 118
88 3300025949 Ga0207667_10084765 Ga0207667_100847652 118
89 3300026041 Ga0207639_10783263 Ga0207639_107832631 118
90 3300026075 Ga0207708_10694081 Ga0207708_106940812 118
91 3300031251 Ga0265327_10000473 Ga0265327_1000047339 119
92 3300031251 Ga0265327_10111797 Ga0265327_101117971 119
93 3300042876 Ga0451577_0300225 Ga0451577_0300225_363_722 119
94 3300045051 Ga0451576_0374961 Ga0451576_0374961_517_876 119
95 3300046809 Ga0495600_0607789 Ga0495600_0607789_259_618 119
96 3300003320 rootH2_10170922 rootH2_101709223 120
97 3300003323 rootH1_10014015 rootH1_100140152 120
98 3300003323 rootH1_10014016 rootH1_100140162 120
99 3300005841 Ga0068863_100393668 Ga0068863_1003936681 120
100 3300013100 Ga0157373_10129208 Ga0157373_101292082 120
101 3300013307 Ga0157372_10030289 Ga0157372_100302895 120
102 3300013307 Ga0157372_12544025 Ga0157372_125440252 120
103 3300026041 Ga0207639_11828371 Ga0207639_118283711 120
104 3300026088 Ga0207641_10130103 Ga0207641_101301033 120
105 3300026116 Ga0207674_10200561 Ga0207674_102005614 120
106 3300037471 Ga0395905_0000601 Ga0395905_0000601_31465_31827 120
107 3300005354 Ga0070675_100296842 Ga0070675_1002968422 121
108 3300005459 Ga0068867_100805263 Ga0068867_1008052632 121
109 3300025926 Ga0207659_11547410 Ga0207659_115474102 121
110 3300044712 Ga0453684_0009766 Ga0453684_0009766_5013_5384 121
111 3300045051 Ga0451576_0007064 Ga0451576_0007064_9554_9925 121
112 3300002774 JGI25150J39212_1000013 JGI25150J39212_1000013139 122
113 3300003187 JGI25151J46595_10000004 JGI25151J46595_1000000431 122
114 3300003215 JGI25153J46596_10000004 JGI25153J46596_1000000431 122
115 3300005614 Ga0068856_102041265 Ga0068856_1020412651 122
116 3300005618 Ga0068864_101030542 Ga0068864_1010305422 122
117 3300005834 Ga0068851_10000105 Ga0068851_1000010512 122
118 3300013102 Ga0157371_10165613 Ga0157371_101656132 122
119 3300013296 Ga0157374_10726246 Ga0157374_107262461 122
120 3300013307 Ga0157372_10287096 Ga0157372_102870964 122
121 3300013307 Ga0157372_10618075 Ga0157372_106180752 122
122 3300025245 Ga0207425_1000008 Ga0207425_1000008401 122
123 3300025254 Ga0209148_1054303 Ga0209148_10543031 122
124 3300025258 Ga0209129_1000042 Ga0209129_1000042136 122
125 3300025294 Ga0209025_1000020 Ga0209025_1000020401 122
126 3300025297 Ga0209758_1000022 Ga0209758_1000022401 122
127 3300025321 Ga0207656_10000170 Ga0207656_100001708 122
128 3300025932 Ga0207690_10273105 Ga0207690_102731052 122
129 3300031344 Ga0265316_10770527 Ga0265316_107705271 122
130 3300031595 Ga0265313_10150321 Ga0265313_101503212 122
131 3300031852 Ga0307410_11223731 Ga0307410_112237311 122
132 3300034818 Ga0373950_0094437 Ga0373950_0094437_67_435 122
133 3300042876 Ga0451577_1117092 Ga0451577_1117092_24_395 122
134 3300042876 Ga0451577_1142327 Ga0451577_1142327_31_399 122
135 3300044712 Ga0453684_0035163 Ga0453684_0035163_2715_3083 122
136 3300044712 Ga0453684_0278200 Ga0453684_0278200_625_996 122
137 3300044712 Ga0453684_0565346 Ga0453684_0565346_367_750 122
138 3300044712 Ga0453684_0644853 Ga0453684_0644853_58_453 122
139 3300045051 Ga0451576_0385194 Ga0451576_0385194_909_1277 122
140 3300046683 Ga0495658_0849122 Ga0495658_0849122_27_437 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05635

23S_rRNA_IVP

23S rRNA-intervening sequence protein

29

135

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gsc-assembly1.cif.gz_C crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.8926 6 112
5x11-assembly4.cif.gz_H crystal structure of bacillus subtilis padr in complex with operator dna 0.8868 56 113
2gsc-assembly1.cif.gz_D crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.882 6 113
6snr-assembly1.cif.gz_A crystal structure of femx 0.8777 57 122
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.8754 6 110
ID Description Score Start End Superfamily
2rldC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.8941 3 110 1.20.1440.60
2gscC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.8926 6 112 1.20.1440.60
2rldE00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.8924 6 110 1.20.1440.60
2gscA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.8773 6 115 1.20.1440.60
2rldD00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.8709 4 110 1.20.1440.60
ID Description Score Start End GO Terms
AF-A0A554SNV6-F1-model_v4 deleted 0.9982 7 115
AF-F0SBA5-F1-model_v4 Four helix bundle protein 0.9973 1 118
AF-A0A3D2EZR7-F1-model_v4 Four helix bundle protein 0.994 6 113
AF-A0A0G1R6H3-F1-model_v4 Four helix bundle protein 0.9928 7 110
AF-A0A1F5UDH1-F1-model_v4 Four helix bundle protein 0.9926 2 119

Feature Viewer

pLDDT pTM Quality
96.65 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map