F181682

General Info

Members Datasets Scaffolds Average Seq Length
141 108 282 354

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100227210|Ga0070660_1002272103
Length 363
Sequence MAVALSQPTYFAARPSIRIDGQIQPTFGDELLQSLLVEETTAGLFRCEARFENWGPSGNGQGLLLFDGSVLHFGKVFAVEFGPSGDSNAVFAGRISGIEAHYPAGRPPELTILAEDRFQDLRLTRRTRSFENVSDSDVIRTIAGDHGLTPQIDVDGPTYRVLTQVNQSDLAFLRERAAAIDAELWVDGNTLYAQLRGRRSAGTIKFTYGRNLLEFSVLADLADQRSSVRVSGWDVGGKEAIDEEADEAAISPELNGGMSGGAVLDRALAKHVERIVSAVPLSRDEARRMAQARYRERARRFVRGSGVVDGNVHIRVGATVELDGLGPWFDGGYYVTAARHTFDLRHGFRTAFEAERPGIAGSS

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
76 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
82 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
93 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
96 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
108 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.26
Rhizosphere 87.23
Stem 0
Stem Tuber 0
Unclassified 9.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100227210 3300005339 Bacteria 1518
2 JGI25406J46586_10012774 3300003203 Bacteria 3630
3 rootH1_10017470 3300003316 Bacteria 13500
4 rootL2_10006881 3300003322 Bacteria 64959
5 Ga0065712_10071969 3300005290 Bacteria 4960
6 Ga0065715_10091893 3300005293 Bacteria 5480
7 Ga0065715_10095166 3300005293 Viruses 4148
8 Ga0070683_100000019 3300005329 Bacteria 192076
9 Ga0070683_100004045 3300005329 Bacteria 12012
10 Ga0070670_100002674 3300005331 Bacteria 14723
11 Ga0070682_100164112 3300005337 Bacteria 1537
12 Ga0070689_100380515 3300005340 Bacteria 1189
13 Ga0070661_100013161 3300005344 Bacteria 5806
14 Ga0070692_10007458 3300005345 Bacteria 4816
15 Ga0070675_100064677 3300005354 Unclassified 3024
16 Ga0070671_100102054 3300005355 Unclassified 2407
17 Ga0070688_100096278 3300005365 Unclassified 1944
18 Ga0070667_100025115 3300005367 Bacteria 4953
19 Ga0070701_10003943 3300005438 Bacteria 5935
20 Ga0070705_100185376 3300005440 Unclassified 1413
21 Ga0070694_100001703 3300005444 Bacteria 12946
22 Ga0070694_100002241 3300005444 Bacteria 11421
23 Ga0070706_100049969 3300005467 Bacteria 3859
24 Ga0070706_100172075 3300005467 Unclassified 2022
25 Ga0070707_100020247 3300005468 Bacteria 6274
26 Ga0070707_100191865 3300005468 Bacteria 1992
27 Ga0070707_100264995 3300005468 Unclassified 1671
28 Ga0070698_100000325 3300005471 Bacteria 48768
29 Ga0070698_100019620 3300005471 Bacteria 7092
30 Ga0070699_100061186 3300005518 Bacteria 3264
31 Ga0070699_100091855 3300005518 Bacteria 2654
32 Ga0070684_100000003 3300005535 Bacteria 248527
33 Ga0070684_100002136 3300005535 Bacteria 14591
34 Ga0070697_100025582 3300005536 Bacteria 4707
35 Ga0068853_100000922 3300005539 Bacteria 20563
36 Ga0070686_100002704 3300005544 Bacteria 9759
37 Ga0070695_100002147 3300005545 Bacteria 11306
38 Ga0070695_100050409 3300005545 Bacteria 2668
39 Ga0070704_100041879 3300005549 Unclassified 3164
40 Ga0070704_100083654 3300005549 Bacteria 2356
41 Ga0070664_100000607 3300005564 Bacteria 27439
42 Ga0068857_100056209 3300005577 Bacteria 3493
43 Ga0068854_100240415 3300005578 Bacteria 1442
44 Ga0068852_100078860 3300005616 Bacteria 2915
45 Ga0068859_100050493 3300005617 Unclassified 4178
46 Ga0068864_100024379 3300005618 Bacteria 5089
47 Ga0068864_100161479 3300005618 Bacteria 2037
48 Ga0068862_100301095 3300005844 Bacteria 1475
49 Ga0070717_10072976 3300006028 Bacteria 2867
50 Ga0097621_100004590 3300006237 Bacteria 9641
51 Ga0068871_100001663 3300006358 Bacteria 14949
52 Ga0075434_100005205 3300006871 Bacteria 11812
53 Ga0075436_100072111 3300006914 Bacteria 2389
54 Ga0097620_100050494 3300006931 Unclassified 4178
55 Ga0111539_10000021 3300009094 Bacteria 246864
56 Ga0111539_10002551 3300009094 Bacteria 24111
57 Ga0111539_10489964 3300009094 Bacteria 1432
58 Ga0114129_10021435 3300009147 Bacteria 9172
59 Ga0114129_10024637 3300009147 Bacteria 8528
60 Ga0114129_10056146 3300009147 Bacteria 5517
61 Ga0105243_10139386 3300009148 Bacteria 2067
62 Ga0105241_10008531 3300009174 Bacteria 7536
63 Ga0105248_10339455 3300009177 Bacteria 1691
64 Ga0105249_10061860 3300009553 Bacteria 3436
65 Ga0105249_10106327 3300009553 Bacteria 2647
66 Ga0157370_10128360 3300013104 Bacteria 2366
67 Ga0157369_10043341 3300013105 Bacteria 4905
68 Ga0157375_10000087 3300013308 Bacteria 92762
69 Ga0163163_10029228 3300014325 Bacteria 5301
70 Ga0163163_10077328 3300014325 Unclassified 3323
71 Ga0213876_10018180 3300021384 Bacteria 3709
72 Ga0207697_10039111 3300025315 Bacteria 1946
73 Ga0207647_10004829 3300025904 Bacteria 9968
74 Ga0207684_10159196 3300025910 Bacteria 1944
75 Ga0207684_10166529 3300025910 Bacteria 1899
76 Ga0207684_10183808 3300025910 Bacteria 1803
77 Ga0207646_10146027 3300025922 Bacteria 2131
78 Ga0207706_10500039 3300025933 Bacteria 1049
79 Ga0207661_10000019 3300025944 Bacteria 235900
80 Ga0207661_10014677 3300025944 Bacteria 5747
81 Ga0207712_10225776 3300025961 Bacteria 1500
82 Ga0207658_10043949 3300025986 Unclassified 3251
83 Ga0207639_10320484 3300026041 Unclassified 1376
84 Ga0207676_10015092 3300026095 Bacteria 5571
85 Ga0207674_10148870 3300026116 Bacteria 2298
86 Ga0207675_100461973 3300026118 Bacteria 1259
87 Ga0207428_10000915 3300027907 Bacteria 32988
88 Ga0268264_10322511 3300028381 Bacteria 1461
89 Ga0307515_10000178 3300028794 Bacteria 157107
90 Ga0265338_10005470 3300028800 Bacteria 16578
91 Ga0265327_10002645 3300031251 Bacteria 18449
92 Ga0307513_10013387 3300031456 Bacteria 10068
93 Ga0307408_100000010 3300031548 Bacteria 420048
94 Ga0307408_100002070 3300031548 Bacteria 14442
95 Ga0307508_10006015 3300031616 Bacteria 11446
96 Ga0307508_10024773 3300031616 Bacteria 5445
97 Ga0307410_10181522 3300031852 Bacteria 1594
98 Ga0373956_0022197 3300035119 Bacteria 2714
99 Ga0373946_0045260 3300035171 Bacteria 1820
100 Ga0373935_0017551 3300035692 Bacteria 4344
101 Ga0373935_0154944 3300035692 Bacteria 1557
102 Ga0373937_0026598 3300036401 Bacteria 5228
103 Ga0373937_0261778 3300036401 Bacteria 1631
104 Ga0373925_0004777 3300037068 Bacteria 10205
105 Ga0395905_0018140 3300037471 Bacteria 6679
106 Ga0400490_44662 3300038726 Bacteria 23632
107 Ga0400489_04986 3300039093 Bacteria 6905
108 Ga0436365_0224936 3300039437 Bacteria 3059
109 Ga0436365_0411388 3300039437 Bacteria 1464
110 Ga0436365_1925590 3300039437 Bacteria 5518
111 Ga0436361_0181011 3300039447 Unclassified 1631
112 Ga0466972_0020834 3300044658 Bacteria 3273
113 Ga0466965_0012805 3300044683 Bacteria 3948
114 Ga0466961_0091942 3300044693 Unclassified 1916
115 Ga0453684_0002574 3300044712 Bacteria 43521
116 Ga0453684_0002589 3300044712 Bacteria 43284
117 Ga0453684_0004027 3300044712 Bacteria 31972
118 Ga0453684_0163336 3300044712 Bacteria 2632
119 Ga0453684_0264814 3300044712 Bacteria 1967
120 Ga0451576_0029812 3300045051 Bacteria 5836
121 Ga0451576_0212938 3300045051 Bacteria 2018
122 Ga0495650_0001820 3300046471 Bacteria 19141
123 Ga0495616_0000791 3300046513 Bacteria 23145
124 Ga0495663_0020509 3300046525 Bacteria 1897
125 Ga0495642_0027643 3300046528 Bacteria 2258
126 Ga0495645_0159450 3300046543 Bacteria 1561
127 Ga0495636_0006262 3300047318 Bacteria 4674
128 Ga0495685_016675 3300047447 Bacteria 2511
129 Ga0496104_0001279 3300048907 Bacteria 21682
130 Ga0496108_0001898 3300048911 Bacteria 16747
131 Ga0496109_0002303 3300048912 Bacteria 15887
132 Ga0496110_0014175 3300048913 Bacteria 6613
133 Ga0496111_0001557 3300048914 Bacteria 13223
134 Ga0496112_0004205 3300048915 Bacteria 12137
135 Ga0501047_0149782 3300049581 Bacteria 2210
136 Ga0501069_0118672 3300049585 Bacteria 1510
137 nmdc:mga05p37_10868_c1 3300050507 Bacteria 10809
138 nmdc:mga05p37_7791_c2 3300050507 Bacteria 9079
139 nmdc:mga08y16_6169_c1 3300050511 Bacteria 12578
140 Ga0495619_0082649 3300053085 Bacteria 2165
141 Ga0590075_006513 3300059424 Bacteria 2768
142 Ga0070660_100227210
143 JGI25406J46586_10012774
144 rootH1_10017470
145 rootL2_10006881
146 Ga0065712_10071969
147 Ga0065715_10091893
148 Ga0065715_10095166
149 Ga0070683_100000019
150 Ga0070683_100004045
151 Ga0070670_100002674
152 Ga0070682_100164112
153 Ga0070689_100380515
154 Ga0070661_100013161
155 Ga0070692_10007458
156 Ga0070675_100064677
157 Ga0070671_100102054
158 Ga0070688_100096278
159 Ga0070667_100025115
160 Ga0070701_10003943
161 Ga0070705_100185376
162 Ga0070694_100001703
163 Ga0070694_100002241
164 Ga0070706_100049969
165 Ga0070706_100172075
166 Ga0070707_100020247
167 Ga0070707_100191865
168 Ga0070707_100264995
169 Ga0070698_100000325
170 Ga0070698_100019620
171 Ga0070699_100061186
172 Ga0070699_100091855
173 Ga0070684_100000003
174 Ga0070684_100002136
175 Ga0070697_100025582
176 Ga0068853_100000922
177 Ga0070686_100002704
178 Ga0070695_100002147
179 Ga0070695_100050409
180 Ga0070704_100041879
181 Ga0070704_100083654
182 Ga0070664_100000607
183 Ga0068857_100056209
184 Ga0068854_100240415
185 Ga0068852_100078860
186 Ga0068859_100050493
187 Ga0068864_100024379
188 Ga0068864_100161479
189 Ga0068862_100301095
190 Ga0070717_10072976
191 Ga0097621_100004590
192 Ga0068871_100001663
193 Ga0075434_100005205
194 Ga0075436_100072111
195 Ga0097620_100050494
196 Ga0111539_10000021
197 Ga0111539_10002551
198 Ga0111539_10489964
199 Ga0114129_10021435
200 Ga0114129_10024637
201 Ga0114129_10056146
202 Ga0105243_10139386
203 Ga0105241_10008531
204 Ga0105248_10339455
205 Ga0105249_10061860
206 Ga0105249_10106327
207 Ga0157370_10128360
208 Ga0157369_10043341
209 Ga0157375_10000087
210 Ga0163163_10029228
211 Ga0163163_10077328
212 Ga0213876_10018180
213 Ga0207697_10039111
214 Ga0207647_10004829
215 Ga0207684_10159196
216 Ga0207684_10166529
217 Ga0207684_10183808
218 Ga0207646_10146027
219 Ga0207706_10500039
220 Ga0207661_10000019
221 Ga0207661_10014677
222 Ga0207712_10225776
223 Ga0207658_10043949
224 Ga0207639_10320484
225 Ga0207676_10015092
226 Ga0207674_10148870
227 Ga0207675_100461973
228 Ga0207428_10000915
229 Ga0268264_10322511
230 Ga0307515_10000178
231 Ga0265338_10005470
232 Ga0265327_10002645
233 Ga0307513_10013387
234 Ga0307408_100000010
235 Ga0307408_100002070
236 Ga0307508_10006015
237 Ga0307508_10024773
238 Ga0307410_10181522
239 Ga0373956_0022197
240 Ga0373946_0045260
241 Ga0373935_0017551
242 Ga0373935_0154944
243 Ga0373937_0026598
244 Ga0373937_0261778
245 Ga0373925_0004777
246 Ga0395905_0018140
247 Ga0400490_44662
248 Ga0400489_04986
249 Ga0436365_0224936
250 Ga0436365_0411388
251 Ga0436365_1925590
252 Ga0436361_0181011
253 Ga0466972_0020834
254 Ga0466965_0012805
255 Ga0466961_0091942
256 Ga0453684_0002574
257 Ga0453684_0002589
258 Ga0453684_0004027
259 Ga0453684_0163336
260 Ga0453684_0264814
261 Ga0451576_0029812
262 Ga0451576_0212938
263 Ga0495650_0001820
264 Ga0495616_0000791
265 Ga0495663_0020509
266 Ga0495642_0027643
267 Ga0495645_0159450
268 Ga0495636_0006262
269 Ga0495685_016675
270 Ga0496104_0001279
271 Ga0496108_0001898
272 Ga0496109_0002303
273 Ga0496110_0014175
274 Ga0496111_0001557
275 Ga0496112_0004205
276 Ga0501047_0149782
277 Ga0501069_0118672
278 nmdc:mga05p37_10868_c1
279 nmdc:mga05p37_7791_c2
280 nmdc:mga08y16_6169_c1
281 Ga0495619_0082649
282 Ga0590075_006513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b5h-assembly1.cif.gz_AJ cryo-em structure of the contractile injection system base plate from anabaena pcc7120 0.8629 13 349
6j0m-assembly1.cif.gz_C cryo-em structure of an extracellular contractile injection system, pvc baseplate in extended state (reconstructed with c3 symmetry) 0.8333 14 347
7aef-assembly1.cif.gz_q cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 3-fold symmetry. 0.8308 1 354
6rbk-assembly1.cif.gz_C cryo-em structure of the anti-feeding prophage (afp) baseplate in extended state, 3-fold symmetrised 0.8293 14 355
7aef-assembly1.cif.gz_q cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 3-fold symmetry. 0.8177 1 354
ID Description Score Start End Superfamily
3cddB02 Alpha Beta;3-Layer(bab) Sandwich;Phage tail protein beta-alpha-beta fold;Baseplate protein-like domains 0.869 122 187 3.55.50.10
2p5zX02 Alpha Beta;3-Layer(bab) Sandwich;Phage tail protein beta-alpha-beta fold;Baseplate protein-like domains 0.8137 110 186 3.55.50.10
3gr5A01 Alpha Beta;3-Layer(bab) Sandwich;Phage tail protein beta-alpha-beta fold; 0.7905 115 188 3.55.50.30
1wruA03 Alpha Beta;2-Layer Sandwich;Phage tail proteins - 2 layer sandwich fold;Baseplate protein-like domains - 2 layer sandwich fold 0.7897 213 289 3.30.1920.10
1k28D03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Bacteriophage T4, Gp27, baseplate hub, domain 3 0.7753 293 348 2.40.30.150
ID Description Score Start End GO Terms
AF-A0A833AM78-F1-model_v4 Phage late control D family protein 0.9688 108 355
AF-A0A0Q7B8A6-F1-model_v4 Phage late control D family protein 0.9684 6 355
AF-A0A5M3Y7N1-F1-model_v4 deleted 0.965 17 355
AF-A0A2W6ZF74-F1-model_v4 Phage late control D family protein 0.9623 4 353
AF-A0A1I5JPK5-F1-model_v4 Phage protein D 0.9614 4 354

Map