F183192

General Info

Members Datasets Scaffolds Average Seq Length
141 91 141 145

Family's Representative Sequence

Representative Sequence 3300034818|Ga0373950_0000013|Ga0373950_0000013_38290_38763
Length 157
Sequence MNMKAIIESIGKVGSRVRMGEHELVFDQPSTVPGGEDRGPSPLDVMSVSVAACAHYFAAAYLHGWGLSPAGLTVEVTAEKQRVPVSRIGRLALKVTLPVGLEDRHAAGIERAIKSCPAYGTLLHSPSVELSIERAATGEVGEGHVEDGGAPSGKLTA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
41 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
42 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
43 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
44 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
47 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
48 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
49 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
54 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
55 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
58 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
63 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
64 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
65 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
66 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
69 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
70 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
73 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
74 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
78 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
79 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
80 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
81 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
82 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
83 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
86 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
87 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
90 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
91 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.77
Rhizosphere 84.4
Stem 0
Stem Tuber 0
Unclassified 2.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10017562 3300003320 Bacteria 20698
2 rootL2_10371582 3300003322 Bacteria 1325
3 rootH1_10170855 3300003323 Bacteria 3201
4 rootH1_10337037 3300003323 Unclassified 1851
5 Ga0070683_100086854 3300005329 Bacteria 2933
6 Ga0070683_100501128 3300005329 Bacteria 1160
7 Ga0070690_100487002 3300005330 Unclassified 920
8 Ga0068869_101279910 3300005334 Bacteria 646
9 Ga0070682_101113869 3300005337 Bacteria 662
10 Ga0068868_100302884 3300005338 Bacteria 1358
11 Ga0070688_100171305 3300005365 Bacteria 1499
12 Ga0070688_100472561 3300005365 Bacteria 941
13 Ga0070713_100288138 3300005436 Bacteria 1508
14 Ga0070710_10790095 3300005437 Unclassified 677
15 Ga0070679_100012432 3300005530 Bacteria 8133
16 Ga0070679_100072284 3300005530 Bacteria 3441
17 Ga0070684_100300806 3300005535 Unclassified 1472
18 Ga0068853_100002285 3300005539 Bacteria 14317
19 Ga0068855_100002104 3300005563 Bacteria 24636
20 Ga0068855_100109790 3300005563 Bacteria 3167
21 Ga0068857_101424179 3300005577 Unclassified 674
22 Ga0068854_100871768 3300005578 Unclassified 789
23 Ga0068856_100028217 3300005614 Bacteria 5480
24 Ga0068856_100139851 3300005614 Bacteria 2428
25 Ga0068856_100172955 3300005614 Bacteria 2172
26 Ga0068856_100429853 3300005614 Unclassified 1341
27 Ga0068856_100445971 3300005614 Unclassified 1315
28 Ga0068856_101264139 3300005614 Unclassified 754
29 Ga0068852_100028986 3300005616 Bacteria 4540
30 Ga0068852_100067775 3300005616 Bacteria 3121
31 Ga0068852_100256220 3300005616 Bacteria 1678
32 Ga0068861_100016279 3300005719 Bacteria 5258
33 Ga0068861_101113436 3300005719 Bacteria 759
34 Ga0068858_100401613 3300005842 Bacteria 1317
35 Ga0070712_100768266 3300006175 Unclassified 825
36 Ga0105237_10086521 3300009545 Bacteria 3124
37 Ga0105238_10003778 3300009551 Bacteria 15045
38 Ga0105238_10896649 3300009551 Bacteria 905
39 Ga0157369_10495906 3300013105 Bacteria 1263
40 Ga0157376_11548984 3300014969 Bacteria 696
41 Ga0207671_10301830 3300025914 Bacteria 1265
42 Ga0207660_10031915 3300025917 Bacteria 3633
43 Ga0207652_10001235 3300025921 Bacteria 22894
44 Ga0207652_10017975 3300025921 Bacteria 5792
45 Ga0207694_10030031 3300025924 Bacteria 4150
46 Ga0207700_10248123 3300025928 Bacteria 1520
47 Ga0207670_10923693 3300025936 Bacteria 732
48 Ga0207667_10028379 3300025949 Bacteria 6079
49 Ga0207667_10269238 3300025949 Bacteria 1741
50 Ga0207677_10178156 3300026023 Bacteria 1669
51 Ga0207677_10995812 3300026023 Bacteria 760
52 Ga0207639_10001699 3300026041 Bacteria 14856
53 Ga0207702_10291641 3300026078 Unclassified 1546
54 Ga0207702_10444760 3300026078 Bacteria 1257
55 Ga0207702_10611151 3300026078 Bacteria 1070
56 Ga0207702_11902966 3300026078 Unclassified 586
57 Ga0207641_10201318 3300026088 Bacteria 1836
58 Ga0207675_100249937 3300026118 Bacteria 1716
59 Ga0207698_10089245 3300026142 Bacteria 2517
60 Ga0265318_10000020 3300028577 Bacteria 166887
61 Ga0265336_10027788 3300028666 Bacteria 1770
62 Ga0265330_10000011 3300031235 Bacteria 183176
63 Ga0265332_10000043 3300031238 Bacteria 117186
64 Ga0265328_10014221 3300031239 Bacteria 3136
65 Ga0265320_10000043 3300031240 Bacteria 124028
66 Ga0265320_10070647 3300031240 Bacteria 1646
67 Ga0265329_10002212 3300031242 Bacteria 8975
68 Ga0265340_10209597 3300031247 Bacteria 875
69 Ga0265340_10338811 3300031247 Unclassified 665
70 Ga0265339_10028020 3300031249 Bacteria 3207
71 Ga0265331_10000035 3300031250 Bacteria 199191
72 Ga0265316_10001283 3300031344 Bacteria 27008
73 Ga0265313_10000010 3300031595 Bacteria 166869
74 Ga0265313_10020034 3300031595 Bacteria 3703
75 Ga0265314_10000094 3300031711 Bacteria 134574
76 Ga0265314_10078961 3300031711 Bacteria 2177
77 Ga0265342_10000825 3300031712 Bacteria 31112
78 Ga0265342_10001764 3300031712 Bacteria 19740
79 Ga0373950_0000002 3300034818 Bacteria 933559
80 Ga0373950_0000011 3300034818 Bacteria 365678
81 Ga0373950_0000013 3300034818 Bacteria 344674
82 Ga0373934_0138636 3300035086 Unclassified 994
83 Ga0373954_0061134 3300035118 Bacteria 1778
84 Ga0373956_0479304 3300035119 Bacteria 594
85 Ga0373955_0254313 3300035172 Bacteria 1054
86 Ga0373933_0028687 3300035724 Bacteria 3212
87 Ga0373947_1152992 3300035725 Unclassified 528
88 Ga0373937_0039670 3300036401 Bacteria 4292
89 Ga0373937_0263450 3300036401 Bacteria 1626
90 Ga0373937_0803846 3300036401 Bacteria 888
91 Ga0451807_0117058 3300041486 Unclassified 516
92 Ga0495603_0762571 3300046455 Bacteria 552
93 Ga0495635_0926667 3300046663 Unclassified 557
94 Ga0496101_0048414 3300048904 Bacteria 3055
95 Ga0496104_0048027 3300048907 Bacteria 4025
96 Ga0496104_0069585 3300048907 Unclassified 3345
97 Ga0496104_1404635 3300048907 Bacteria 601
98 Ga0496105_0125175 3300048908 Bacteria 2119
99 Ga0496105_0254272 3300048908 Bacteria 1422
100 Ga0496106_0022219 3300048909 Bacteria 4712
101 Ga0496107_0180401 3300048910 Bacteria 1568
102 Ga0496110_1405376 3300048913 Bacteria 607
103 Ga0496112_0096169 3300048915 Bacteria 2932
104 Ga0496112_0711454 3300048915 Unclassified 932
105 Ga0496114_0001460 3300048917 Bacteria 17957
106 Ga0496114_0011887 3300048917 Bacteria 6967
107 Ga0496114_0042658 3300048917 Bacteria 3761
108 Ga0496115_0022740 3300048918 Bacteria 4861
109 Ga0496115_0064432 3300048918 Bacteria 2958
110 Ga0496115_0317318 3300048918 Unclassified 1275
111 Ga0501032_0234159 3300049569 Bacteria 1194
112 Ga0501036_0009594 3300049572 Bacteria 7960
113 Ga0501036_0033164 3300049572 Bacteria 4367
114 Ga0501042_0517062 3300049578 Bacteria 867
115 Ga0501067_0000009 3300049583 Bacteria 123458
116 Ga0501067_0000846 3300049583 Bacteria 16500
117 Ga0501067_0001719 3300049583 Bacteria 12029
118 Ga0501067_0012447 3300049583 Bacteria 4720
119 Ga0501068_0066612 3300049584 Bacteria 2194
120 Ga0501070_0000108 3300049586 Bacteria 72665
121 Ga0501070_0363739 3300049586 Bacteria 1173
122 Ga0501071_0063055 3300049587 Unclassified 2687
123 Ga0501072_0000454 3300049588 Bacteria 29564
124 Ga0501073_0000245 3300049589 Bacteria 35756
125 Ga0501073_0001731 3300049589 Bacteria 16220
126 Ga0501073_0005301 3300049589 Bacteria 9670
127 Ga0501073_0365856 3300049589 Bacteria 996
128 Ga0501073_0862053 3300049589 Bacteria 624
129 Ga0501074_0466333 3300049590 Bacteria 895
130 Ga0501075_0406184 3300049591 Bacteria 1038
131 Ga0501080_0035137 3300049742 Bacteria 4679
132 Ga0501080_0040672 3300049742 Bacteria 4336
133 Ga0501080_0055430 3300049742 Bacteria 3692
134 Ga0501080_1697558 3300049742 Unclassified 533
135 Ga0501080_1829073 3300049742 Unclassified 510
136 Ga0501081_0197570 3300049743 Bacteria 1458
137 Ga0501083_0003030 3300049744 Bacteria 11672
138 Ga0501044_0161547 3300049823 Bacteria 2217
139 Ga0495619_0426959 3300053085 Unclassified 914
140 Ga0501084_0919444 3300054114 Bacteria 736
141 Ga0501082_0041042 3300060353 Bacteria 3989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0048027 Ga0496104_0048027_2785_3174 110
2 3300009551 Ga0105238_10003778 Ga0105238_100037784 111
3 3300049583 Ga0501067_0012447 Ga0501067_0012447_1323_1796 111
4 3300046663 Ga0495635_0926667 Ga0495635_0926667_143_544 116
5 3300049742 Ga0501080_1697558 Ga0501080_1697558_14_421 116
6 3300049742 Ga0501080_1829073 Ga0501080_1829073_82_468 116
7 3300041486 Ga0451807_0117058 Ga0451807_0117058_39_425 117
8 3300035172 Ga0373955_0254313 Ga0373955_0254313_405_836 121
9 3300003322 rootL2_10371582 rootL2_103715822 132
10 3300003323 rootH1_10170855 rootH1_101708554 132
11 3300003323 rootH1_10337037 rootH1_103370372 132
12 3300005329 Ga0070683_100086854 Ga0070683_1000868543 132
13 3300005329 Ga0070683_100501128 Ga0070683_1005011282 132
14 3300005330 Ga0070690_100487002 Ga0070690_1004870021 132
15 3300005334 Ga0068869_101279910 Ga0068869_1012799101 132
16 3300005337 Ga0070682_101113869 Ga0070682_1011138691 132
17 3300005338 Ga0068868_100302884 Ga0068868_1003028841 132
18 3300005365 Ga0070688_100171305 Ga0070688_1001713052 132
19 3300005365 Ga0070688_100472561 Ga0070688_1004725611 132
20 3300005436 Ga0070713_100288138 Ga0070713_1002881382 132
21 3300005437 Ga0070710_10790095 Ga0070710_107900951 132
22 3300005530 Ga0070679_100012432 Ga0070679_1000124327 132
23 3300005530 Ga0070679_100072284 Ga0070679_1000722843 132
24 3300005535 Ga0070684_100300806 Ga0070684_1003008062 132
25 3300005539 Ga0068853_100002285 Ga0068853_10000228515 132
26 3300005563 Ga0068855_100002104 Ga0068855_10000210425 132
27 3300005563 Ga0068855_100109790 Ga0068855_1001097903 132
28 3300005577 Ga0068857_101424179 Ga0068857_1014241791 132
29 3300005578 Ga0068854_100871768 Ga0068854_1008717682 132
30 3300005614 Ga0068856_100028217 Ga0068856_1000282178 132
31 3300005614 Ga0068856_100139851 Ga0068856_1001398512 132
32 3300005614 Ga0068856_100172955 Ga0068856_1001729552 132
33 3300005614 Ga0068856_100429853 Ga0068856_1004298532 132
34 3300005614 Ga0068856_100445971 Ga0068856_1004459713 132
35 3300005614 Ga0068856_101264139 Ga0068856_1012641392 132
36 3300005616 Ga0068852_100028986 Ga0068852_1000289866 132
37 3300005616 Ga0068852_100067775 Ga0068852_1000677753 132
38 3300005616 Ga0068852_100256220 Ga0068852_1002562203 132
39 3300005719 Ga0068861_100016279 Ga0068861_1000162792 132
40 3300005842 Ga0068858_100401613 Ga0068858_1004016131 132
41 3300006175 Ga0070712_100768266 Ga0070712_1007682662 132
42 3300009545 Ga0105237_10086521 Ga0105237_100865214 132
43 3300009551 Ga0105238_10896649 Ga0105238_108966491 132
44 3300013105 Ga0157369_10495906 Ga0157369_104959062 132
45 3300014969 Ga0157376_11548984 Ga0157376_115489842 132
46 3300025914 Ga0207671_10301830 Ga0207671_103018302 132
47 3300025917 Ga0207660_10031915 Ga0207660_100319154 132
48 3300025921 Ga0207652_10001235 Ga0207652_1000123513 132
49 3300025921 Ga0207652_10017975 Ga0207652_100179753 132
50 3300025924 Ga0207694_10030031 Ga0207694_100300316 132
51 3300025928 Ga0207700_10248123 Ga0207700_102481232 132
52 3300025936 Ga0207670_10923693 Ga0207670_109236932 132
53 3300025949 Ga0207667_10028379 Ga0207667_100283797 132
54 3300025949 Ga0207667_10269238 Ga0207667_102692382 132
55 3300026023 Ga0207677_10178156 Ga0207677_101781561 132
56 3300026023 Ga0207677_10995812 Ga0207677_109958122 132
57 3300026041 Ga0207639_10001699 Ga0207639_1000169916 132
58 3300026078 Ga0207702_10291641 Ga0207702_102916411 132
59 3300026078 Ga0207702_10444760 Ga0207702_104447602 132
60 3300026078 Ga0207702_10611151 Ga0207702_106111512 132
61 3300026078 Ga0207702_11902966 Ga0207702_119029661 132
62 3300026088 Ga0207641_10201318 Ga0207641_102013182 132
63 3300026118 Ga0207675_100249937 Ga0207675_1002499372 132
64 3300026142 Ga0207698_10089245 Ga0207698_100892453 132
65 3300028577 Ga0265318_10000020 Ga0265318_1000002097 132
66 3300028666 Ga0265336_10027788 Ga0265336_100277882 132
67 3300031235 Ga0265330_10000011 Ga0265330_1000001197 132
68 3300031238 Ga0265332_10000043 Ga0265332_100000434 132
69 3300031239 Ga0265328_10014221 Ga0265328_100142213 132
70 3300031240 Ga0265320_10000043 Ga0265320_1000004333 132
71 3300031240 Ga0265320_10070647 Ga0265320_100706472 132
72 3300031242 Ga0265329_10002212 Ga0265329_100022128 132
73 3300031247 Ga0265340_10209597 Ga0265340_102095972 132
74 3300031247 Ga0265340_10338811 Ga0265340_103388111 132
75 3300031249 Ga0265339_10028020 Ga0265339_100280202 132
76 3300031250 Ga0265331_10000035 Ga0265331_1000003574 132
77 3300031344 Ga0265316_10001283 Ga0265316_1000128323 132
78 3300031595 Ga0265313_10000010 Ga0265313_1000001045 132
79 3300031595 Ga0265313_10020034 Ga0265313_100200344 132
80 3300031711 Ga0265314_10000094 Ga0265314_1000009497 132
81 3300031711 Ga0265314_10078961 Ga0265314_100789612 132
82 3300031712 Ga0265342_10000825 Ga0265342_100008253 132
83 3300031712 Ga0265342_10001764 Ga0265342_1000176411 132
84 3300034818 Ga0373950_0000002 Ga0373950_0000002_148239_148670 132
85 3300034818 Ga0373950_0000011 Ga0373950_0000011_286528_286959 132
86 3300034818 Ga0373950_0000013 Ga0373950_0000013_38290_38763 132
87 3300035086 Ga0373934_0138636 Ga0373934_0138636_501_971 132
88 3300035118 Ga0373954_0061134 Ga0373954_0061134_414_848 132
89 3300035119 Ga0373956_0479304 Ga0373956_0479304_138_569 132
90 3300035724 Ga0373933_0028687 Ga0373933_0028687_1018_1458 132
91 3300035725 Ga0373947_1152992 Ga0373947_1152992_46_480 132
92 3300036401 Ga0373937_0039670 Ga0373937_0039670_3478_3933 132
93 3300036401 Ga0373937_0263450 Ga0373937_0263450_512_946 132
94 3300036401 Ga0373937_0803846 Ga0373937_0803846_358_786 132
95 3300046455 Ga0495603_0762571 Ga0495603_0762571_73_516 132
96 3300048904 Ga0496101_0048414 Ga0496101_0048414_2014_2451 132
97 3300048907 Ga0496104_0069585 Ga0496104_0069585_2630_3082 132
98 3300048907 Ga0496104_1404635 Ga0496104_1404635_82_513 132
99 3300048908 Ga0496105_0125175 Ga0496105_0125175_13_465 132
100 3300048908 Ga0496105_0254272 Ga0496105_0254272_786_1241 132
101 3300048909 Ga0496106_0022219 Ga0496106_0022219_3236_3673 132
102 3300048910 Ga0496107_0180401 Ga0496107_0180401_599_1051 132
103 3300048913 Ga0496110_1405376 Ga0496110_1405376_97_528 132
104 3300048915 Ga0496112_0096169 Ga0496112_0096169_1841_2293 132
105 3300048915 Ga0496112_0711454 Ga0496112_0711454_65_493 132
106 3300048917 Ga0496114_0001460 Ga0496114_0001460_8410_8847 132
107 3300048917 Ga0496114_0011887 Ga0496114_0011887_2386_2838 132
108 3300048917 Ga0496114_0042658 Ga0496114_0042658_272_703 132
109 3300048918 Ga0496115_0022740 Ga0496115_0022740_2667_3122 132
110 3300048918 Ga0496115_0064432 Ga0496115_0064432_302_739 132
111 3300048918 Ga0496115_0317318 Ga0496115_0317318_399_830 132
112 3300049569 Ga0501032_0234159 Ga0501032_0234159_632_1093 132
113 3300049572 Ga0501036_0009594 Ga0501036_0009594_796_1245 132
114 3300049572 Ga0501036_0033164 Ga0501036_0033164_3497_3937 132
115 3300049578 Ga0501042_0517062 Ga0501042_0517062_205_633 132
116 3300049583 Ga0501067_0000009 Ga0501067_0000009_75593_76024 132
117 3300049583 Ga0501067_0000846 Ga0501067_0000846_12079_12510 132
118 3300049583 Ga0501067_0001719 Ga0501067_0001719_7698_8138 132
119 3300049584 Ga0501068_0066612 Ga0501068_0066612_314_739 132
120 3300049586 Ga0501070_0000108 Ga0501070_0000108_68504_68929 132
121 3300049586 Ga0501070_0363739 Ga0501070_0363739_647_1069 132
122 3300049587 Ga0501071_0063055 Ga0501071_0063055_184_612 132
123 3300049588 Ga0501072_0000454 Ga0501072_0000454_18080_18511 132
124 3300049589 Ga0501073_0000245 Ga0501073_0000245_1507_1938 132
125 3300049589 Ga0501073_0001731 Ga0501073_0001731_4962_5393 132
126 3300049589 Ga0501073_0005301 Ga0501073_0005301_5025_5450 132
127 3300049589 Ga0501073_0365856 Ga0501073_0365856_275_736 132
128 3300049589 Ga0501073_0862053 Ga0501073_0862053_102_548 132
129 3300049590 Ga0501074_0466333 Ga0501074_0466333_130_555 132
130 3300049591 Ga0501075_0406184 Ga0501075_0406184_100_528 132
131 3300049742 Ga0501080_0035137 Ga0501080_0035137_2987_3412 132
132 3300049742 Ga0501080_0040672 Ga0501080_0040672_370_798 132
133 3300049742 Ga0501080_0055430 Ga0501080_0055430_1370_1843 132
134 3300049743 Ga0501081_0197570 Ga0501081_0197570_568_993 132
135 3300049744 Ga0501083_0003030 Ga0501083_0003030_6172_6597 132
136 3300049823 Ga0501044_0161547 Ga0501044_0161547_145_588 132
137 3300053085 Ga0495619_0426959 Ga0495619_0426959_222_656 132
138 3300054114 Ga0501084_0919444 Ga0501084_0919444_112_537 132
139 3300060353 Ga0501082_0041042 Ga0501082_0041042_665_1090 132
140 3300003320 rootH2_10017562 rootH2_1001756213 133
141 3300005719 Ga0068861_101113436 Ga0068861_1011134361 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

34

131

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.8848 1 131
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.8805 2 133
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.8665 1 131
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8403 2 133
1vla-assembly1.cif.gz_A crystal structure of hydroperoxide resistance protein osmc (tm0919) from thermotoga maritima at 1.80 a resolution 0.838 1 133
ID Description Score Start End Superfamily
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8815 2 133 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8813 39 133 3.30.300.20
2pn2A00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8359 1 131 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8335 39 133 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8322 2 133 3.30.300.20
ID Description Score Start End GO Terms
AF-Q2B3B9-F1-model_v4 OsmC/Ohr family protein 0.9076 2 133
AF-A0A0M2U071-F1-model_v4 Peroxiredoxin 0.9061 1 133
AF-A0A852ZLF8-F1-model_v4 Putative OsmC-like protein 0.9055 2 125
AF-A0A350V4A1-F1-model_v4 Osmotically inducible protein OsmC 0.9034 33 132
AF-A0A7C4UF62-F1-model_v4 OsmC family peroxiredoxin 0.902 2 133

Feature Viewer

pLDDT pTM Quality
93.51 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map