F183535

General Info

Members Datasets Scaffolds Average Seq Length
141 113 120 258

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0505823|Ga0466967_0505823_197_979
Length 246
Sequence MSASTLAQPSREEITRRVHELGPWFHNLDLLGVSTAPNHFLGDYPAVKWRRFAHLLPDDLTNKTVLDLGCNAGFYSLEMKRRGAARVLGIDFDERYLAQAKMSVYDVAEIGETFDIVLFLGVLYHLRHPLLALDLIHQHVARDLFILQSLQRGSDQIIPLQDDYDFWQTEIFEEAAFPKMYFLEKRYAGDPTNWWIPNRACTAAMLRSAGFEILDQPESEVFVCRRRELPEGPRAIYAAIRRDDYD

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
5 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
6 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
7 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
8 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
9 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
10 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
11 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
12 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
13 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
14 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
15 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
16 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
17 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
18 2909042592 Labrys sp. LIt4 Isolate Nodule
19 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
20 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
81 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
89 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
102 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
113 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.11
Metatranscriptomes 0
Isolates 14.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.67
Nodule 9.22
Rhizoplane 0.71
Rhizosphere 77.3
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10029638 3300002459 Bacteria 1136
2 rootL2_10011318 3300003322 Bacteria 17256
3 Ga0055536_1000135 3300003781 Bacteria 63129
4 Ga0055530_10005429 3300003791 Bacteria 6066
5 Ga0055531_10000219 3300003794 Bacteria 63124
6 Ga0070658_10000345 3300005327 Bacteria 40226
7 Ga0070658_10555454 3300005327 Bacteria 994
8 Ga0070670_100253879 3300005331 Bacteria 1532
9 Ga0070679_100507269 3300005530 Bacteria 1150
10 Ga0068864_100000632 3300005618 Bacteria 29500
11 Ga0068863_100000125 3300005841 Bacteria 80636
12 Ga0068858_100000025 3300005842 Bacteria 160546
13 Ga0081539_10064316 3300005985 Bacteria 1997
14 Ga0075427_10003283 3300006194 Bacteria 2222
15 Ga0075428_100003334 3300006844 Bacteria 17571
16 Ga0075430_100108497 3300006846 Bacteria 2316
17 Ga0075431_100004901 3300006847 Bacteria 13179
18 Ga0075429_100003429 3300006880 Bacteria 13523
19 Ga0105250_10028458 3300009092 Bacteria 2250
20 Ga0105240_10624319 3300009093 Bacteria 1184
21 Ga0111539_10063666 3300009094 Bacteria 4363
22 Ga0114129_10005747 3300009147 Bacteria 17574
23 Ga0114129_10115102 3300009147 Bacteria 3707
24 Ga0105248_10055937 3300009177 Bacteria 4426
25 Ga0105237_10282768 3300009545 Bacteria 1661
26 Ga0105249_10293698 3300009553 Bacteria 1627
27 Ga0105033_101287 3300009986 Bacteria 2043
28 Ga0163163_10193721 3300014325 Bacteria 2080
29 Ga0157379_10004779 3300014968 Bacteria 11636
30 Ga0213876_10041086 3300021384 Bacteria 2444
31 Ga0213871_10036661 3300021441 Bacteria 1302
32 Ga0209676_1000031 3300025292 Bacteria 478976
33 Ga0209050_1000087 3300025298 Bacteria 261460
34 Ga0209257_1000050 3300025304 Bacteria 439325
35 Ga0207696_1026478 3300025711 Bacteria 1794
36 Ga0207705_10015622 3300025909 Bacteria 5450
37 Ga0207705_10091128 3300025909 Bacteria 2232
38 Ga0207671_10210168 3300025914 Bacteria 1522
39 Ga0207650_10185000 3300025925 Bacteria 1662
40 Ga0207687_10526984 3300025927 Bacteria 989
41 Ga0207711_10015742 3300025941 Bacteria 6273
42 Ga0207703_10000105 3300026035 Bacteria 99702
43 Ga0207641_10000012 3300026088 Bacteria 375486
44 Ga0207676_10000315 3300026095 Bacteria 41410
45 Ga0268266_10475484 3300028379 Bacteria 1191
46 Ga0307410_10095962 3300031852 Bacteria 2115
47 Ga0307407_10435946 3300031903 Bacteria 948
48 Ga0307412_10476192 3300031911 Bacteria 1034
49 Ga0307409_100372517 3300031995 Bacteria 1355
50 Ga0307416_100059424 3300032002 Bacteria 3107
51 Ga0307414_10171389 3300032004 Bacteria 1735
52 Ga0307414_10354928 3300032004 Bacteria 1260
53 Ga0307411_10347171 3300032005 Bacteria 1208
54 Ga0307415_100561715 3300032126 Bacteria 1009
55 Ga0373935_0445220 3300035692 Bacteria 935
56 Ga0395899_0000634 3300037312 Bacteria 36392
57 Ga0395899_0042183 3300037312 Bacteria 3407
58 Ga0395900_0000016 3300037418 Bacteria 382407
59 Ga0395900_0122108 3300037418 Bacteria 2672
60 Ga0395900_0312395 3300037418 Bacteria 1554
61 Ga0395898_0062497 3300037466 Bacteria 3616
62 Ga0395905_0008750 3300037471 Bacteria 9957
63 Ga0395905_0013865 3300037471 Bacteria 7711
64 Ga0395905_0035798 3300037471 Bacteria 4662
65 Ga0395905_0043637 3300037471 Bacteria 4206
66 Ga0395905_0088250 3300037471 Bacteria 2907
67 Ga0395905_0891131 3300037471 Unclassified 793
68 Ga0436364_0072566 3300037853 Bacteria 20921
69 Ga0436364_0879466 3300037853 Bacteria 3596
70 Ga0395901_0000022 3300038443 Bacteria 296356
71 Ga0395901_0096673 3300038443 Bacteria 3095
72 Ga0395901_0209875 3300038443 Bacteria 2039
73 Ga0395901_0349569 3300038443 Bacteria 1526
74 Ga0436365_0529113 3300039437 Bacteria 2956
75 Ga0436360_0972256 3300039438 Bacteria 1413
76 Ga0439465_0028907 3300041413 Bacteria 1760
77 Ga0439431_0037848 3300041997 Bacteria 1219
78 Ga0466966_0111488 3300044684 Bacteria 1686
79 Ga0466960_0188331 3300044901 Bacteria 1122
80 Ga0466959_0049340 3300045049 Bacteria 3092
81 Ga0466959_0074201 3300045049 Bacteria 2460
82 Ga0451576_0003336 3300045051 Bacteria 22238
83 Ga0451576_0558925 3300045051 Bacteria 1202
84 Ga0466958_0005913 3300045836 Bacteria 6613
85 Ga0466958_0388784 3300045836 Bacteria 900
86 Ga0466967_0028676 3300045976 Bacteria 4650
87 Ga0466967_0505823 3300045976 Bacteria 1186
88 Ga0495597_0029548 3300046542 Bacteria 2502
89 Ga0495668_0000812 3300046616 Bacteria 35793
90 Ga0495668_0005830 3300046616 Bacteria 8230
91 Ga0495660_0051262 3300046810 Bacteria 2246
92 Ga0495686_0071709 3300047472 Bacteria 2131
93 Ga0496102_0645348 3300048905 Bacteria 982
94 Ga0501033_0305441 3300049570 Bacteria 1119
95 Ga0501034_0075952 3300049571 Bacteria 3367
96 Ga0501040_0164364 3300049576 Bacteria 1570
97 Ga0501043_0321752 3300049579 Bacteria 1179
98 Ga0501047_0126009 3300049581 Bacteria 2441
99 Ga0501047_0469367 3300049581 Bacteria 1087
100 Ga0501048_0049340 3300049582 Bacteria 3000
101 Ga0501075_0122353 3300049591 Bacteria 1981
102 Ga0501076_0106130 3300049592 Bacteria 2267
103 Ga0501238_005133 3300049671 Bacteria 1652
104 Ga0501238_012172 3300049671 Bacteria 1161
105 Ga0501238_017029 3300049671 Bacteria 1011
106 Ga0501257_001194 3300049686 Bacteria 5327
107 Ga0501079_0096201 3300049741 Bacteria 2295
108 Ga0501035_0010661 3300049822 Bacteria 8509
109 Ga0501035_0087658 3300049822 Bacteria 2743
110 Ga0501044_0008469 3300049823 Bacteria 11270
111 Ga0501044_0045184 3300049823 Bacteria 4565
112 nmdc:mga05p37_16589_c1 3300050507 Bacteria 8872
113 nmdc:mga05p37_1772_c1 3300050507 Bacteria 25202
114 nmdc:mga05p37_514421_c1 3300050507 Unclassified 1371
115 nmdc:mga09592_1791_c1 3300050508 Bacteria 17247
116 nmdc:mga0qj67_193605_c1 3300050509 Bacteria 1652
117 nmdc:mga06r32_8351_c1 3300050510 Bacteria 9323
118 Ga0500556_0001296 3300053104 Bacteria 11269
119 Ga0500616_0155878 3300053153 Bacteria 1052
120 Ga0501082_0086107 3300060353 Bacteria 2710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0445220 Ga0373935_0445220_38_730 230
2 3300037471 Ga0395905_0891131 Ga0395905_0891131_36_737 233
3 3300053153 Ga0500616_0155878 Ga0500616_0155878_312_1031 238
4 3300005530 Ga0070679_100507269 Ga0070679_1005072692 239
5 3300009093 Ga0105240_10624319 Ga0105240_106243192 242
6 3300009545 Ga0105237_10282768 Ga0105237_102827682 242
7 3300025914 Ga0207671_10210168 Ga0207671_102101682 242
8 3300028379 Ga0268266_10475484 Ga0268266_104754842 243
9 3300045976 Ga0466967_0505823 Ga0466967_0505823_197_979 243
10 3300003322 rootL2_10011318 rootL2_100113182 246
11 3300005985 Ga0081539_10064316 Ga0081539_100643162 246
12 3300006846 Ga0075430_100108497 Ga0075430_1001084973 248
13 3300009094 Ga0111539_10063666 Ga0111539_100636662 248
14 3300009147 Ga0114129_10115102 Ga0114129_101151023 248
15 3300050507 nmdc:mga05p37_16589_c1 nmdc:mga05p37_16589_c1_6362_7108 248
16 3300050509 nmdc:mga0qj67_193605_c1 nmdc:mga0qj67_193605_c1_263_1009 248
17 iso_pu_bacteria 2909042592 2909047632 248
18 iso_pu_bacteria 2503198000 2503204614 249
19 iso_pu_bacteria 2513237090 2513612600 249
20 iso_pu_bacteria 2693429783 2694629116 249
21 iso_pu_bacteria 2693429784 2694636970 249
22 iso_pu_bacteria 2847670302 2847671109 249
23 iso_pu_bacteria 2856314179 2856316624 249
24 iso_pu_bacteria 2878035449 2878036771 249
25 iso_pu_bacteria 2882456835 2882457438 249
26 iso_pu_bacteria 2906414383 2906416761 249
27 iso_pu_bacteria 2965062239 2965063819 249
28 iso_pu_bacteria 2968128360 2968129687 249
29 3300009147 Ga0114129_10005747 Ga0114129_1000574710 250
30 3300031995 Ga0307409_100372517 Ga0307409_1003725172 250
31 3300032004 Ga0307414_10354928 Ga0307414_103549282 250
32 3300032126 Ga0307415_100561715 Ga0307415_1005617151 250
33 3300041413 Ga0439465_0028907 Ga0439465_0028907_670_1422 250
34 3300041997 Ga0439431_0037848 Ga0439431_0037848_79_831 250
35 3300045836 Ga0466958_0388784 Ga0466958_0388784_52_807 250
36 3300049671 Ga0501238_017029 Ga0501238_017029_232_987 250
37 3300050507 nmdc:mga05p37_1772_c1 nmdc:mga05p37_1772_c1_17129_17887 250
38 3300050508 nmdc:mga09592_1791_c1 nmdc:mga09592_1791_c1_9619_10377 250
39 3300050510 nmdc:mga06r32_8351_c1 nmdc:mga06r32_8351_c1_7519_8277 250
40 3300045051 Ga0451576_0558925 Ga0451576_0558925_345_1118 251
41 3300045976 Ga0466967_0028676 Ga0466967_0028676_2269_3024 251
42 3300049571 Ga0501034_0075952 Ga0501034_0075952_2508_3263 251
43 3300049579 Ga0501043_0321752 Ga0501043_0321752_14_769 251
44 3300049581 Ga0501047_0126009 Ga0501047_0126009_734_1489 251
45 3300049581 Ga0501047_0469367 Ga0501047_0469367_229_984 251
46 3300049822 Ga0501035_0010661 Ga0501035_0010661_667_1422 251
47 3300049823 Ga0501044_0045184 Ga0501044_0045184_2737_3492 251
48 iso_pu_bacteria 2881147464 2881150706 251
49 3300038443 Ga0395901_0349569 Ga0395901_0349569_170_928 252
50 iso_pu_bacteria 2508501050 2508734100 252
51 iso_pu_bacteria 2508501114 2509079040 252
52 iso_pu_bacteria 2835312727 2835317610 252
53 iso_pu_bacteria 2894232714 2894233547 252
54 3300009986 Ga0105033_101287 Ga0105033_1012872 253
55 3300021441 Ga0213871_10036661 Ga0213871_100366612 253
56 3300037471 Ga0395905_0088250 Ga0395905_0088250_1561_2322 253
57 3300038443 Ga0395901_0209875 Ga0395901_0209875_248_1009 253
58 3300039438 Ga0436360_0972256 Ga0436360_0972256_379_1140 253
59 3300049576 Ga0501040_0164364 Ga0501040_0164364_409_1173 253
60 3300049591 Ga0501075_0122353 Ga0501075_0122353_431_1195 253
61 3300049592 Ga0501076_0106130 Ga0501076_0106130_164_928 253
62 3300049741 Ga0501079_0096201 Ga0501079_0096201_969_1733 253
63 3300060353 Ga0501082_0086107 Ga0501082_0086107_353_1117 253
64 iso_pu_bacteria 2671180139 2671693306 253
65 3300009553 Ga0105249_10293698 Ga0105249_102936982 255
66 3300025927 Ga0207687_10526984 Ga0207687_105269842 255
67 3300031852 Ga0307410_10095962 Ga0307410_100959623 255
68 3300031903 Ga0307407_10435946 Ga0307407_104359462 255
69 3300031911 Ga0307412_10476192 Ga0307412_104761922 255
70 3300032002 Ga0307416_100059424 Ga0307416_1000594242 255
71 3300037418 Ga0395900_0122108 Ga0395900_0122108_148_921 255
72 3300037466 Ga0395898_0062497 Ga0395898_0062497_2260_3033 255
73 3300037471 Ga0395905_0008750 Ga0395905_0008750_4137_4910 255
74 3300037471 Ga0395905_0035798 Ga0395905_0035798_506_1279 255
75 3300037853 Ga0436364_0072566 Ga0436364_0072566_19215_19985 255
76 3300038443 Ga0395901_0096673 Ga0395901_0096673_1188_1961 255
77 3300044684 Ga0466966_0111488 Ga0466966_0111488_891_1667 255
78 3300045049 Ga0466959_0049340 Ga0466959_0049340_1130_1906 255
79 iso_pu_bacteria 2511231221 2512035804 255
80 iso_pu_bacteria 8054002106 8054003610 255
81 3300032005 Ga0307411_10347171 Ga0307411_103471712 257
82 3300037853 Ga0436364_0879466 Ga0436364_0879466_1551_2330 258
83 3300005327 Ga0070658_10000345 Ga0070658_1000034523 259
84 3300006194 Ga0075427_10003283 Ga0075427_100032832 259
85 3300006844 Ga0075428_100003334 Ga0075428_10000333410 259
86 3300006847 Ga0075431_100004901 Ga0075431_10000490113 259
87 3300006880 Ga0075429_100003429 Ga0075429_1000034296 259
88 3300025909 Ga0207705_10015622 Ga0207705_100156222 259
89 3300049582 Ga0501048_0049340 Ga0501048_0049340_1740_2525 259
90 3300050507 nmdc:mga05p37_514421_c1 nmdc:mga05p37_514421_c1_344_1129 259
91 3300037312 Ga0395899_0042183 Ga0395899_0042183_1162_1950 260
92 3300037418 Ga0395900_0312395 Ga0395900_0312395_584_1372 260
93 3300037471 Ga0395905_0013865 Ga0395905_0013865_1725_2513 260
94 3300048905 Ga0496102_0645348 Ga0496102_0645348_112_900 260
95 3300049822 Ga0501035_0087658 Ga0501035_0087658_1169_1951 260
96 3300049823 Ga0501044_0008469 Ga0501044_0008469_4028_4810 260
97 3300005327 Ga0070658_10555454 Ga0070658_105554542 261
98 3300025909 Ga0207705_10091128 Ga0207705_100911282 261
99 3300032004 Ga0307414_10171389 Ga0307414_101713892 261
100 3300044901 Ga0466960_0188331 Ga0466960_0188331_202_993 261
101 3300021384 Ga0213876_10041086 Ga0213876_100410862 262
102 3300037312 Ga0395899_0000634 Ga0395899_0000634_25526_26320 262
103 3300037418 Ga0395900_0000016 Ga0395900_0000016_21672_22466 262
104 3300037471 Ga0395905_0043637 Ga0395905_0043637_177_971 262
105 3300038443 Ga0395901_0000022 Ga0395901_0000022_59752_60546 262
106 3300039437 Ga0436365_0529113 Ga0436365_0529113_883_1680 262
107 3300049570 Ga0501033_0305441 Ga0501033_0305441_243_1037 262
108 3300049686 Ga0501257_001194 Ga0501257_001194_3718_4512 262
109 iso_pu_bacteria 2857504554 2857507676 262
110 3300045051 Ga0451576_0003336 Ga0451576_0003336_19931_20728 263
111 3300046616 Ga0495668_0005830 Ga0495668_0005830_181_978 263
112 3300003781 Ga0055536_1000135 Ga0055536_100013518 264
113 3300003791 Ga0055530_10005429 Ga0055530_100054292 264
114 3300003794 Ga0055531_10000219 Ga0055531_1000021918 264
115 3300025292 Ga0209676_1000031 Ga0209676_100003193 264
116 3300025298 Ga0209050_1000087 Ga0209050_1000087178 264
117 3300025304 Ga0209257_1000050 Ga0209257_1000050336 264
118 3300046616 Ga0495668_0000812 Ga0495668_0000812_13847_14650 265
119 3300046810 Ga0495660_0051262 Ga0495660_0051262_847_1650 265
120 3300047472 Ga0495686_0071709 Ga0495686_0071709_707_1510 265
121 3300049671 Ga0501238_005133 Ga0501238_005133_74_877 265
122 3300049671 Ga0501238_012172 Ga0501238_012172_49_852 265
123 3300053104 Ga0500556_0001296 Ga0500556_0001296_3754_4557 265
124 3300005331 Ga0070670_100253879 Ga0070670_1002538792 266
125 3300046542 Ga0495597_0029548 Ga0495597_0029548_77_883 266
126 3300009177 Ga0105248_10055937 Ga0105248_100559372 268
127 3300025941 Ga0207711_10015742 Ga0207711_100157424 268
128 3300045049 Ga0466959_0074201 Ga0466959_0074201_1173_1991 268
129 3300045836 Ga0466958_0005913 Ga0466958_0005913_2367_3185 268
130 3300002459 JGI24751J29686_10029638 JGI24751J29686_100296382 270
131 3300005618 Ga0068864_100000632 Ga0068864_10000063224 270
132 3300005841 Ga0068863_100000125 Ga0068863_10000012515 270
133 3300005842 Ga0068858_100000025 Ga0068858_10000002573 270
134 3300009092 Ga0105250_10028458 Ga0105250_100284582 270
135 3300014325 Ga0163163_10193721 Ga0163163_101937212 270
136 3300014968 Ga0157379_10004779 Ga0157379_100047793 270
137 3300025711 Ga0207696_1026478 Ga0207696_10264781 270
138 3300025925 Ga0207650_10185000 Ga0207650_101850002 270
139 3300026035 Ga0207703_10000105 Ga0207703_1000010556 270
140 3300026088 Ga0207641_10000012 Ga0207641_10000012322 270
141 3300026095 Ga0207676_10000315 Ga0207676_100003157 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

66

143

0.86

PF08003

Methyltransf_9

Protein of unknown function (DUF1698)

1

226

0.78

PF13489

Methyltransf_23

Methyltransferase domain

40

216

0.78

PF13649

Methyltransf_25

Methyltransferase domain

65

143

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i9z-assembly1.cif.gz_CP cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state spb4 0.8804 60 132
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.8584 60 131
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.8432 58 131
3ftp-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.8175 57 129
7qw6-assembly1.cif.gz_A adenine-specific dna methyltransferase m.bseci complexed with adohcy and cognate hemimethylated dna duplex 0.815 60 131
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9019 58 118 3.40.50.150
af_I1JDM5_91_303_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8793 57 152 3.40.50.150
af_Q8ILX8_228_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8739 57 111 3.40.50.150
af_P60393_12_309_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8709 60 130 3.40.50.1000
af_Q54UI9_3_272_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8483 43 153 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A530GNI5-F1-model_v4 DUF1698 domain-containing protein 0.9911 6 126
AF-A0A532E610-F1-model_v4 TIGR04290 family methyltransferase 0.9822 6 239 GO:0008168
GO:0032259
AF-A0A1F8WVW3-F1-model_v4 Methyltransferase, TIGR04290 family 0.9779 6 242 GO:0008168
GO:0032259
AF-A0A7T8YF10-F1-model_v4 deleted 0.9751 6 241
AF-A0A086MDD9-F1-model_v4 SAM-dependent methyltransferase 0.9744 6 250 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
86.64 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map