F186586

General Info

Members Datasets Scaffolds Average Seq Length
142 86 142 294

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0004043|Ga0453684_0004043_14558_15514
Length 318
Sequence LQIRIRAIVHAAVARLLPRKEQPMTTVVLSTDFPDLSLAGRGKVRDMYDLGDALLIVTTDRISAFDVIMNEGIPGKGEVLTQISAHWFRRMEGILANHLITTDVREFPAVCRPYADLLAGRSMLVKKARPLPAECIVRGFLAGSGWKEYRSTGCVCGIRLPEGLVESQRLEEPIFTPSTKAELGAHDENITFERMAELCGADLAEQACQATLAIYRAARDYADSRGILIADTKFEFGVHDGQLILIDECLTPDSSRFWPKDAYRPGTAPPSFDKQYLRDYLETLDWNKKVPAPPLPGEIVQRTAEKYREAMELLFGAP

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
69 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
83 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
84 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
85 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
86 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.59
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10098096 3300005289 Unclassified 2366
2 Ga0065707_10084918 3300005295 Bacteria 6637
3 Ga0065707_10091624 3300005295 Bacteria 3906
4 Ga0070683_100080606 3300005329 Bacteria 3047
5 Ga0070690_100249467 3300005330 Bacteria 1255
6 Ga0070680_100240162 3300005336 Unclassified 1531
7 Ga0070689_100209403 3300005340 Bacteria 1595
8 Ga0070692_10039163 3300005345 Bacteria 2419
9 Ga0070668_100008711 3300005347 Bacteria 7534
10 Ga0070669_100089156 3300005353 Bacteria 2310
11 Ga0070709_10000012 3300005434 Bacteria 163026
12 Ga0070714_100139033 3300005435 Bacteria 2178
13 Ga0070705_100158259 3300005440 Bacteria 1511
14 Ga0070700_100128677 3300005441 Bacteria 1706
15 Ga0070708_100409556 3300005445 Bacteria 1279
16 Ga0068867_100258178 3300005459 Bacteria 1420
17 Ga0070706_100120036 3300005467 Bacteria 2450
18 Ga0070707_100142992 3300005468 Bacteria 2328
19 Ga0070698_100004001 3300005471 Bacteria 16220
20 Ga0070699_100131892 3300005518 Bacteria 2202
21 Ga0070684_100156687 3300005535 Bacteria 2065
22 Ga0070697_100001763 3300005536 Bacteria 16519
23 Ga0070697_100024850 3300005536 Bacteria 4771
24 Ga0070704_100048278 3300005549 Bacteria 2979
25 Ga0070704_100122361 3300005549 Bacteria 2002
26 Ga0068861_100159776 3300005719 Unclassified 1858
27 Ga0068858_100330584 3300005842 Bacteria 1458
28 Ga0068860_100000384 3300005843 Bacteria 57893
29 Ga0068862_100015309 3300005844 Bacteria 6370
30 Ga0081540_1045239 3300005983 Bacteria 2238
31 Ga0070717_10029690 3300006028 Bacteria 4389
32 Ga0070717_10174368 3300006028 Bacteria 1872
33 Ga0070716_100071349 3300006173 Bacteria 2041
34 Ga0075428_100005199 3300006844 Bacteria 14459
35 Ga0075434_100018888 3300006871 Bacteria 6663
36 Ga0075429_100114345 3300006880 Bacteria 2359
37 Ga0068865_100000805 3300006881 Bacteria 17622
38 Ga0075436_100000395 3300006914 Bacteria 28036
39 Ga0075436_100078678 3300006914 Bacteria 2284
40 Ga0075435_100314899 3300007076 Bacteria 1339
41 Ga0105240_10047314 3300009093 Bacteria 5444
42 Ga0111539_10591680 3300009094 Bacteria 1292
43 Ga0105245_10314100 3300009098 Bacteria 1542
44 Ga0114129_10013446 3300009147 Bacteria 11664
45 Ga0105249_10002547 3300009553 Bacteria 15780
46 Ga0163162_10019911 3300013306 Bacteria 6590
47 Ga0157375_10034290 3300013308 Bacteria 4835
48 Ga0157380_10012286 3300014326 Bacteria 6207
49 Ga0157379_10069755 3300014968 Bacteria 3144
50 Ga0224712_10085378 3300022467 Bacteria 1311
51 Ga0207699_10000087 3300025906 Bacteria 69697
52 Ga0207695_10047438 3300025913 Bacteria 4546
53 Ga0207660_10225173 3300025917 Unclassified 1473
54 Ga0207646_10034753 3300025922 Bacteria 4556
55 Ga0207646_10145295 3300025922 Bacteria 2137
56 Ga0207687_10300890 3300025927 Bacteria 1292
57 Ga0207700_10123222 3300025928 Bacteria 2105
58 Ga0207664_10242578 3300025929 Bacteria 1570
59 Ga0207670_10013023 3300025936 Bacteria 4890
60 Ga0207665_10011801 3300025939 Bacteria 5742
61 Ga0207658_10151320 3300025986 Bacteria 1891
62 Ga0207703_10270992 3300026035 Bacteria 1538
63 Ga0207641_10021820 3300026088 Bacteria 5265
64 Ga0207648_10002271 3300026089 Bacteria 20796
65 Ga0207428_10200480 3300027907 Unclassified 1502
66 Ga0268264_10001034 3300028381 Bacteria 27952
67 Ga0265326_10003000 3300028558 Bacteria 5613
68 Ga0265319_1003051 3300028563 Bacteria 8867
69 Ga0265318_10000313 3300028577 Bacteria 38864
70 Ga0265336_10007167 3300028666 Bacteria 3979
71 Ga0265338_10046220 3300028800 Bacteria 3991
72 Ga0265338_10049156 3300028800 Bacteria 3826
73 Ga0265340_10011343 3300031247 Bacteria 4738
74 Ga0265340_10033828 3300031247 Bacteria 2543
75 Ga0265327_10003382 3300031251 Bacteria 15344
76 Ga0316579_10017295 3300031691 Bacteria 3160
77 Ga0373951_0000899 3300035091 Bacteria 8013
78 Ga0316582_0027962 3300036647 Unclassified 3412
79 Ga0316584_0042019 3300036712 Bacteria 3409
80 Ga0436364_1558185 3300037853 Bacteria 1487
81 Ga0436365_1475218 3300039437 Bacteria 1064
82 Ga0451577_0000035 3300042876 Bacteria 373467
83 Ga0451577_0000070 3300042876 Bacteria 238621
84 Ga0451577_0025714 3300042876 Bacteria 5340
85 Ga0451577_0030949 3300042876 Bacteria 4832
86 Ga0451577_0062379 3300042876 Bacteria 3324
87 Ga0451577_0085595 3300042876 Bacteria 2813
88 Ga0451577_0218422 3300042876 Bacteria 1723
89 Ga0451577_0271722 3300042876 Bacteria 1535
90 Ga0453683_0000020 3300044673 Bacteria 286813
91 Ga0453683_0000050 3300044673 Bacteria 202054
92 Ga0453683_0000555 3300044673 Bacteria 41398
93 Ga0453683_0014155 3300044673 Bacteria 5184
94 Ga0453683_0021271 3300044673 Bacteria 4142
95 Ga0453683_0034435 3300044673 Bacteria 3193
96 Ga0453683_0043366 3300044673 Bacteria 2823
97 Ga0453683_0049308 3300044673 Bacteria 2640
98 Ga0453684_0000097 3300044712 Bacteria 377772
99 Ga0453684_0000233 3300044712 Bacteria 240186
100 Ga0453684_0000383 3300044712 Bacteria 181393
101 Ga0453684_0000436 3300044712 Bacteria 170125
102 Ga0453684_0002393 3300044712 Bacteria 45725
103 Ga0453684_0003817 3300044712 Bacteria 33232
104 Ga0453684_0004043 3300044712 Bacteria 31888
105 Ga0453684_0004399 3300044712 Bacteria 29811
106 Ga0453684_0005282 3300044712 Bacteria 25787
107 Ga0453684_0008394 3300044712 Bacteria 18532
108 Ga0453684_0010207 3300044712 Bacteria 16106
109 Ga0453684_0014325 3300044712 Bacteria 12702
110 Ga0453684_0016453 3300044712 Bacteria 11563
111 Ga0453684_0018208 3300044712 Bacteria 10805
112 Ga0453684_0044408 3300044712 Bacteria 5947
113 Ga0453684_0047893 3300044712 Bacteria 5661
114 Ga0453684_0126478 3300044712 Bacteria 3075
115 Ga0453684_0129394 3300044712 Bacteria 3031
116 Ga0453684_0179498 3300044712 Bacteria 2486
117 Ga0453684_0268853 3300044712 Bacteria 1949
118 Ga0453684_0310479 3300044712 Bacteria 1789
119 Ga0453684_0384463 3300044712 Bacteria 1575
120 Ga0453684_0644458 3300044712 Bacteria 1157
121 Ga0453684_0645372 3300044712 Bacteria 1156
122 Ga0451576_0000049 3300045051 Bacteria 323945
123 Ga0451576_0001566 3300045051 Bacteria 38485
124 Ga0451576_0001588 3300045051 Bacteria 38190
125 Ga0451576_0007726 3300045051 Bacteria 12777
126 Ga0451576_0009922 3300045051 Bacteria 10995
127 Ga0451576_0054762 3300045051 Bacteria 4175
128 Ga0451576_0057462 3300045051 Bacteria 4067
129 Ga0451576_0159728 3300045051 Bacteria 2352
130 Ga0451576_0301973 3300045051 Bacteria 1675
131 Ga0451576_0410508 3300045051 Bacteria 1420
132 Ga0495602_0049513 3300048088 Bacteria 3763
133 Ga0501034_0073959 3300049571 Bacteria 3416
134 Ga0501037_0196200 3300049573 Bacteria 1428
135 Ga0501070_0097167 3300049586 Bacteria 2436
136 nmdc:mga05p37_166_c1 3300050507 Bacteria 63976
137 nmdc:mga08y16_79487_c1 3300050511 Bacteria 3418
138 nmdc:mga0n895_28836_c1 3300050512 Bacteria 5285
139 nmdc:mga0rr50_26192_c1 3300050513 Bacteria 4064
140 nmdc:mga0rr50_307914_c1 3300050513 Bacteria 1326
141 nmdc:mga08x19_10_c1 3300050514 Bacteria 404490
142 nmdc:mga08x19_35632_c1 3300050514 Bacteria 3149

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006914 Ga0075436_100000395 Ga0075436_1000003953 234
2 3300005340 Ga0070689_100209403 Ga0070689_1002094031 250
3 3300050513 nmdc:mga0rr50_26192_c1 nmdc:mga0rr50_26192_c1_256_1065 250
4 3300005336 Ga0070680_100240162 Ga0070680_1002401621 251
5 3300025917 Ga0207660_10225173 Ga0207660_102251731 251
6 3300005719 Ga0068861_100159776 Ga0068861_1001597763 252
7 3300006844 Ga0075428_100005199 Ga0075428_1000051997 252
8 3300027907 Ga0207428_10200480 Ga0207428_102004802 252
9 3300037853 Ga0436364_1558185 Ga0436364_1558185_207_974 254
10 3300006871 Ga0075434_100018888 Ga0075434_1000188886 262
11 3300006914 Ga0075436_100078678 Ga0075436_1000786783 262
12 3300007076 Ga0075435_100314899 Ga0075435_1003148992 262
13 3300006880 Ga0075429_100114345 Ga0075429_1001143452 264
14 3300009147 Ga0114129_10013446 Ga0114129_100134466 264
15 3300044673 Ga0453683_0043366 Ga0453683_0043366_1240_2091 264
16 3300050507 nmdc:mga05p37_166_c1 nmdc:mga05p37_166_c1_16480_17331 264
17 3300050511 nmdc:mga08y16_79487_c1 nmdc:mga08y16_79487_c1_1997_2848 264
18 3300050512 nmdc:mga0n895_28836_c1 nmdc:mga0n895_28836_c1_2737_3588 264
19 3300050513 nmdc:mga0rr50_307914_c1 nmdc:mga0rr50_307914_c1_154_1005 264
20 3300050514 nmdc:mga08x19_10_c1 nmdc:mga08x19_10_c1_75220_76065 264
21 3300050514 nmdc:mga08x19_35632_c1 nmdc:mga08x19_35632_c1_764_1615 264
22 3300044712 Ga0453684_0645372 Ga0453684_0645372_14_811 265
23 3300005434 Ga0070709_10000012 Ga0070709_100000125 275
24 3300005549 Ga0070704_100122361 Ga0070704_1001223612 275
25 3300006173 Ga0070716_100071349 Ga0070716_1000713493 275
26 3300025906 Ga0207699_10000087 Ga0207699_1000008759 275
27 3300025922 Ga0207646_10145295 Ga0207646_101452953 275
28 3300025928 Ga0207700_10123222 Ga0207700_101232223 275
29 3300025939 Ga0207665_10011801 Ga0207665_100118013 275
30 3300005983 Ga0081540_1045239 Ga0081540_10452392 276
31 3300049586 Ga0501070_0097167 Ga0501070_0097167_1213_2052 276
32 3300036647 Ga0316582_0027962 Ga0316582_0027962_784_1662 285
33 3300039437 Ga0436365_1475218 Ga0436365_1475218_170_1030 285
34 3300031691 Ga0316579_10017295 Ga0316579_100172953 286
35 3300036712 Ga0316584_0042019 Ga0316584_0042019_1345_2238 286
36 3300005440 Ga0070705_100158259 Ga0070705_1001582591 287
37 3300005435 Ga0070714_100139033 Ga0070714_1001390332 290
38 3300005467 Ga0070706_100120036 Ga0070706_1001200363 290
39 3300005536 Ga0070697_100024850 Ga0070697_1000248504 290
40 3300006028 Ga0070717_10174368 Ga0070717_101743682 290
41 3300025929 Ga0207664_10242578 Ga0207664_102425781 290
42 3300031251 Ga0265327_10003382 Ga0265327_100033829 290
43 3300035091 Ga0373951_0000899 Ga0373951_0000899_5247_6125 290
44 3300044673 Ga0453683_0021271 Ga0453683_0021271_310_1188 290
45 3300044712 Ga0453684_0268853 Ga0453684_0268853_929_1807 290
46 3300045051 Ga0451576_0007726 Ga0451576_0007726_4181_5059 290
47 3300005353 Ga0070669_100089156 Ga0070669_1000891561 291
48 3300005441 Ga0070700_100128677 Ga0070700_1001286772 291
49 3300005843 Ga0068860_100000384 Ga0068860_10000038454 291
50 3300005844 Ga0068862_100015309 Ga0068862_1000153094 291
51 3300006881 Ga0068865_100000805 Ga0068865_10000080511 291
52 3300009553 Ga0105249_10002547 Ga0105249_100025477 291
53 3300013306 Ga0163162_10019911 Ga0163162_100199112 291
54 3300014326 Ga0157380_10012286 Ga0157380_100122866 291
55 3300025986 Ga0207658_10151320 Ga0207658_101513202 291
56 3300026089 Ga0207648_10002271 Ga0207648_100022714 291
57 3300028381 Ga0268264_10001034 Ga0268264_100010343 291
58 3300042876 Ga0451577_0062379 Ga0451577_0062379_256_1158 291
59 3300044712 Ga0453684_0047893 Ga0453684_0047893_4731_5606 291
60 3300045051 Ga0451576_0001566 Ga0451576_0001566_26284_27159 291
61 3300005295 Ga0065707_10084918 Ga0065707_100849183 292
62 3300028800 Ga0265338_10049156 Ga0265338_100491564 292
63 3300031247 Ga0265340_10011343 Ga0265340_100113433 292
64 3300031247 Ga0265340_10033828 Ga0265340_100338282 292
65 3300005445 Ga0070708_100409556 Ga0070708_1004095561 293
66 3300005468 Ga0070707_100142992 Ga0070707_1001429922 293
67 3300005471 Ga0070698_100004001 Ga0070698_1000040014 293
68 3300005518 Ga0070699_100131892 Ga0070699_1001318922 293
69 3300005536 Ga0070697_100001763 Ga0070697_1000017633 293
70 3300006028 Ga0070717_10029690 Ga0070717_100296904 293
71 3300009093 Ga0105240_10047314 Ga0105240_100473144 293
72 3300025913 Ga0207695_10047438 Ga0207695_100474383 293
73 3300025922 Ga0207646_10034753 Ga0207646_100347534 293
74 3300044712 Ga0453684_0644458 Ga0453684_0644458_17_898 293
75 3300045051 Ga0451576_0054762 Ga0451576_0054762_1539_2420 293
76 3300049571 Ga0501034_0073959 Ga0501034_0073959_1022_1939 293
77 3300049573 Ga0501037_0196200 Ga0501037_0196200_147_1064 293
78 3300005329 Ga0070683_100080606 Ga0070683_1000806064 294
79 3300005345 Ga0070692_10039163 Ga0070692_100391632 294
80 3300005347 Ga0070668_100008711 Ga0070668_1000087111 294
81 3300005459 Ga0068867_100258178 Ga0068867_1002581781 294
82 3300005535 Ga0070684_100156687 Ga0070684_1001566872 294
83 3300005842 Ga0068858_100330584 Ga0068858_1003305842 294
84 3300009098 Ga0105245_10314100 Ga0105245_103141002 294
85 3300013308 Ga0157375_10034290 Ga0157375_100342904 294
86 3300014968 Ga0157379_10069755 Ga0157379_100697553 294
87 3300022467 Ga0224712_10085378 Ga0224712_100853782 294
88 3300025927 Ga0207687_10300890 Ga0207687_103008902 294
89 3300026035 Ga0207703_10270992 Ga0207703_102709921 294
90 3300042876 Ga0451577_0000070 Ga0451577_0000070_89211_90101 294
91 3300044712 Ga0453684_0008394 Ga0453684_0008394_15514_16404 294
92 3300044712 Ga0453684_0018208 Ga0453684_0018208_2931_3815 294
93 3300048088 Ga0495602_0049513 Ga0495602_0049513_1916_2818 294
94 3300005330 Ga0070690_100249467 Ga0070690_1002494671 295
95 3300005549 Ga0070704_100048278 Ga0070704_1000482782 295
96 3300009094 Ga0111539_10591680 Ga0111539_105916801 295
97 3300025936 Ga0207670_10013023 Ga0207670_100130232 295
98 3300026088 Ga0207641_10021820 Ga0207641_100218201 295
99 3300028558 Ga0265326_10003000 Ga0265326_100030005 295
100 3300028563 Ga0265319_1003051 Ga0265319_10030515 295
101 3300028577 Ga0265318_10000313 Ga0265318_1000031332 295
102 3300028666 Ga0265336_10007167 Ga0265336_100071674 295
103 3300028800 Ga0265338_10046220 Ga0265338_100462203 295
104 3300044712 Ga0453684_0000436 Ga0453684_0000436_108901_109788 295
105 3300044712 Ga0453684_0004043 Ga0453684_0004043_14558_15514 295
106 3300044712 Ga0453684_0179498 Ga0453684_0179498_716_1603 295
107 3300044712 Ga0453684_0384463 Ga0453684_0384463_496_1383 295
108 3300045051 Ga0451576_0009922 Ga0451576_0009922_2448_3338 295
109 3300005289 Ga0065704_10098096 Ga0065704_100980962 296
110 3300005295 Ga0065707_10091624 Ga0065707_100916241 296
111 3300042876 Ga0451577_0000035 Ga0451577_0000035_140194_141084 296
112 3300042876 Ga0451577_0025714 Ga0451577_0025714_1836_2726 296
113 3300042876 Ga0451577_0030949 Ga0451577_0030949_634_1527 296
114 3300042876 Ga0451577_0085595 Ga0451577_0085595_467_1357 296
115 3300042876 Ga0451577_0218422 Ga0451577_0218422_77_967 296
116 3300042876 Ga0451577_0271722 Ga0451577_0271722_588_1478 296
117 3300044673 Ga0453683_0000020 Ga0453683_0000020_69270_70160 296
118 3300044673 Ga0453683_0000050 Ga0453683_0000050_145210_146100 296
119 3300044673 Ga0453683_0000555 Ga0453683_0000555_15952_16842 296
120 3300044673 Ga0453683_0014155 Ga0453683_0014155_3744_4634 296
121 3300044673 Ga0453683_0034435 Ga0453683_0034435_1757_2647 296
122 3300044673 Ga0453683_0049308 Ga0453683_0049308_406_1296 296
123 3300044712 Ga0453684_0000097 Ga0453684_0000097_140201_141091 296
124 3300044712 Ga0453684_0000233 Ga0453684_0000233_27264_28154 296
125 3300044712 Ga0453684_0000383 Ga0453684_0000383_100246_101136 296
126 3300044712 Ga0453684_0002393 Ga0453684_0002393_21325_22215 296
127 3300044712 Ga0453684_0003817 Ga0453684_0003817_10184_11074 296
128 3300044712 Ga0453684_0004399 Ga0453684_0004399_26027_26917 296
129 3300044712 Ga0453684_0005282 Ga0453684_0005282_12559_13449 296
130 3300044712 Ga0453684_0010207 Ga0453684_0010207_4599_5489 296
131 3300044712 Ga0453684_0014325 Ga0453684_0014325_10590_11480 296
132 3300044712 Ga0453684_0016453 Ga0453684_0016453_1403_2293 296
133 3300044712 Ga0453684_0044408 Ga0453684_0044408_3476_4375 296
134 3300044712 Ga0453684_0126478 Ga0453684_0126478_2123_3013 296
135 3300044712 Ga0453684_0129394 Ga0453684_0129394_1614_2504 296
136 3300044712 Ga0453684_0310479 Ga0453684_0310479_202_1092 296
137 3300045051 Ga0451576_0000049 Ga0451576_0000049_276213_277103 296
138 3300045051 Ga0451576_0001588 Ga0451576_0001588_23785_24678 296
139 3300045051 Ga0451576_0057462 Ga0451576_0057462_1117_2007 296
140 3300045051 Ga0451576_0159728 Ga0451576_0159728_1015_1905 296
141 3300045051 Ga0451576_0301973 Ga0451576_0301973_509_1399 296
142 3300045051 Ga0451576_0410508 Ga0451576_0410508_194_1084 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

38

293

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9471 7 295
1obd-assembly1.cif.gz_A saicar-synthase complexed with atp 0.9273 5 296
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9222 7 295
1obg-assembly1.cif.gz_A saicar-synthase complexed with atp 0.9219 3 296
2cnv-assembly1.cif.gz_A saicar-synthase from saccharomyces cerevisiae complexed saicar 0.9181 7 296
ID Description Score Start End Superfamily
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9826 106 248 3.30.470.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9627 106 248 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9571 106 248 3.30.470.20
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9395 108 241 3.30.470.20
af_P38025_96_184_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9378 11 106 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A3S4W3U4-F1-model_v4 deleted 0.996 103 210
AF-A0A7Z9Y8X1-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9953 3 102 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A3C1BV40-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9947 3 247 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-X0V669-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9944 1 148 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-X0TZU3-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9941 2 91 GO:0004639
GO:0005524
GO:0005737
GO:0006189

Feature Viewer

pLDDT pTM Quality
94.55 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map