F187698

General Info

Members Datasets Scaffolds Average Seq Length
143 107 286 129

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100049345|Ga0070683_1000493454
Length 121
Sequence LSAEVSKVSPEEARRLADQGAQLVDVRADHEWEAGRIAGASHIELSTLAERSGEIDRDRPVVVYCRGGSRSEMAAEALAGEGFEAVVLEGGLPAWEPEAAFVAESGEAAAILQARKSPAGP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
54 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
64 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
67 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
68 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
72 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
75 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
76 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
77 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
78 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
79 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
80 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
96 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
97 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
98 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
104 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
105 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 20.98
Rhizosphere 74.13
Stem 0
Stem Tuber 0
Unclassified 6.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100049345 3300005329 Bacteria 3893
2 JGI24740J21852_10003290 3300001979 Bacteria 7123
3 JGI24034J26672_10001295 3300002239 Bacteria 3295
4 Ga0068869_100049440 3300005334 Unclassified 3044
5 Ga0070691_10000010 3300005341 Bacteria 58327
6 Ga0070671_100034729 3300005355 Bacteria 4175
7 Ga0070674_100000016 3300005356 Bacteria 91058
8 Ga0070710_10590428 3300005437 Bacteria 772
9 Ga0070711_100009636 3300005439 Bacteria 5953
10 Ga0070685_10003014 3300005466 Bacteria 8586
11 Ga0070679_100004239 3300005530 Bacteria 13233
12 Ga0070684_101914599 3300005535 Bacteria 560
13 Ga0068853_100415758 3300005539 Bacteria 1260
14 Ga0070686_101458561 3300005544 Bacteria 575
15 Ga0070695_100063325 3300005545 Bacteria 2404
16 Ga0070665_100832877 3300005548 Bacteria 936
17 Ga0068857_100424587 3300005577 Bacteria 1240
18 Ga0068856_100274163 3300005614 Bacteria 1703
19 Ga0068866_10000148 3300005718 Bacteria 31770
20 Ga0068866_10050714 3300005718 Bacteria 2109
21 Ga0068863_100058765 3300005841 Bacteria 3639
22 Ga0068863_100082388 3300005841 Bacteria 3049
23 Ga0068860_100221452 3300005843 Bacteria 1838
24 Ga0070716_100070104 3300006173 Bacteria 2057
25 Ga0075435_100762352 3300007076 Bacteria 842
26 Ga0105245_10362584 3300009098 Unclassified 1438
27 Ga0105245_10763615 3300009098 Bacteria 1003
28 Ga0105242_10003532 3300009176 Bacteria 12150
29 Ga0105242_10005935 3300009176 Bacteria 9420
30 Ga0105242_10040376 3300009176 Bacteria 3760
31 Ga0157347_1027589 3300012502 Bacteria 697
32 Ga0157370_10019858 3300013104 Bacteria 6724
33 Ga0157370_10424791 3300013104 Bacteria 1222
34 Ga0157375_10298983 3300013308 Bacteria 1773
35 Ga0157375_11170588 3300013308 Bacteria 901
36 Ga0157375_13599460 3300013308 Unclassified 515
37 Ga0163163_11454918 3300014325 Bacteria 747
38 Ga0157380_10000024 3300014326 Bacteria 110947
39 Ga0157379_11137884 3300014968 Bacteria 749
40 Ga0157376_10083529 3300014969 Bacteria 2747
41 Ga0207642_10000051 3300025899 Bacteria 34399
42 Ga0207642_10015731 3300025899 Bacteria 2829
43 Ga0207710_10001475 3300025900 Bacteria 11675
44 Ga0207647_10178154 3300025904 Bacteria 1236
45 Ga0207693_10846729 3300025915 Unclassified 703
46 Ga0207663_10001468 3300025916 Bacteria 10989
47 Ga0207687_10026252 3300025927 Bacteria 3898
48 Ga0207686_10000271 3300025934 Bacteria 38452
49 Ga0207686_10001838 3300025934 Bacteria 11810
50 Ga0207686_10307873 3300025934 Bacteria 1179
51 Ga0207669_10000064 3300025937 Bacteria 52977
52 Ga0207665_10119550 3300025939 Bacteria 1860
53 Ga0207689_10246888 3300025942 Bacteria 1476
54 Ga0207661_10167919 3300025944 Bacteria 1908
55 Ga0207668_10269346 3300025972 Bacteria 1392
56 Ga0207639_10131308 3300026041 Unclassified 2074
57 Ga0207678_10080253 3300026067 Bacteria 2793
58 Ga0207641_10007515 3300026088 Bacteria 9070
59 Ga0207641_10553067 3300026088 Bacteria 1122
60 Ga0207648_10001998 3300026089 Bacteria 22263
61 Ga0268266_10773337 3300028379 Bacteria 927
62 Ga0268265_11999810 3300028380 Bacteria 587
63 Ga0268264_10143734 3300028381 Bacteria 2131
64 Ga0265338_10000047 3300028800 Bacteria 220905
65 Ga0265324_10081504 3300029957 Bacteria 1101
66 Ga0307511_10212500 3300030521 Bacteria 985
67 Ga0265331_10185724 3300031250 Bacteria 938
68 Ga0265316_10589097 3300031344 Bacteria 789
69 Ga0265342_10054376 3300031712 Bacteria 2379
70 Ga0451853_2140586 3300041512 Bacteria 514
71 Ga0466967_0000008 3300045976 Bacteria 127135
72 Ga0495592_0131488 3300046454 Bacteria 1750
73 Ga0495603_0000044 3300046455 Bacteria 53548
74 Ga0495629_0001046 3300046459 Bacteria 22155
75 Ga0495629_0001573 3300046459 Bacteria 17953
76 Ga0495629_0400504 3300046459 Bacteria 933
77 Ga0495582_0000307 3300046473 Bacteria 27037
78 Ga0495594_0000217 3300046499 Bacteria 28038
79 Ga0495606_0000219 3300046507 Bacteria 101614
80 Ga0495608_0557185 3300046511 Unclassified 690
81 Ga0495618_0393981 3300046514 Bacteria 848
82 Ga0495628_0010777 3300046516 Bacteria 7741
83 Ga0495630_0004625 3300046517 Bacteria 9651
84 Ga0495630_0206560 3300046517 Bacteria 1499
85 Ga0495640_0103474 3300046533 Unclassified 1867
86 Ga0495621_0025305 3300046539 Unclassified 1993
87 Ga0495656_0002074 3300046615 Bacteria 6613
88 Ga0495634_0000030 3300046642 Bacteria 110741
89 Ga0495634_0194730 3300046642 Bacteria 1262
90 Ga0495623_0258301 3300046679 Bacteria 977
91 Ga0495658_0000190 3300046683 Bacteria 35518
92 Ga0495658_0007818 3300046683 Bacteria 5294
93 Ga0495676_0036209 3300047321 Bacteria 4123
94 Ga0495686_0081354 3300047472 Bacteria 1978
95 Ga0495614_0426887 3300048089 Bacteria 625
96 Ga0496100_0000046 3300048903 Bacteria 77660
97 Ga0496101_0000124 3300048904 Bacteria 75495
98 Ga0496102_0000404 3300048905 Bacteria 50274
99 Ga0496103_0000001 3300048906 Bacteria 643471
100 Ga0496103_0083664 3300048906 Bacteria 2009
101 Ga0496104_0000002 3300048907 Bacteria 686017
102 Ga0496104_0000139 3300048907 Bacteria 67432
103 Ga0496104_0479713 3300048907 Bacteria 1155
104 Ga0496105_0000001 3300048908 Bacteria 1328178
105 Ga0496105_0000054 3300048908 Bacteria 89081
106 Ga0496106_0000059 3300048909 Bacteria 87781
107 Ga0496107_0000018 3300048910 Bacteria 158433
108 Ga0496108_0002243 3300048911 Bacteria 15470
109 Ga0496108_0034683 3300048911 Bacteria 4192
110 Ga0496109_0000291 3300048912 Bacteria 47681
111 Ga0496109_0009757 3300048912 Bacteria 8194
112 Ga0496109_0065700 3300048912 Bacteria 3321
113 Ga0496110_0000476 3300048913 Bacteria 27211
114 Ga0496110_0021001 3300048913 Bacteria 5518
115 Ga0496110_0319787 3300048913 Bacteria 1413
116 Ga0496111_0006837 3300048914 Bacteria 7439
117 Ga0496111_0007693 3300048914 Bacteria 7087
118 Ga0496111_0221593 3300048914 Bacteria 1405
119 Ga0496112_0000002 3300048915 Bacteria 782039
120 Ga0496113_0026877 3300048916 Bacteria 4119
121 Ga0496113_0214717 3300048916 Bacteria 1532
122 Ga0496114_0000043 3300048917 Bacteria 131720
123 Ga0496114_0343345 3300048917 Bacteria 1320
124 Ga0496115_0000211 3300048918 Bacteria 54033
125 Ga0496115_0072353 3300048918 Bacteria 2797
126 Ga0496118_0473536 3300048921 Bacteria 630
127 Ga0496119_0034424 3300048922 Bacteria 3336
128 Ga0496120_0027417 3300048923 Bacteria 3504
129 Ga0496124_0090556 3300048927 Bacteria 2495
130 Ga0501046_1037774 3300049580 Bacteria 568
131 Ga0501047_0897723 3300049581 Bacteria 700
132 Ga0501070_0016779 3300049586 Bacteria 6147
133 Ga0501070_0039167 3300049586 Bacteria 3954
134 Ga0501072_0376420 3300049588 Bacteria 1127
135 Ga0495601_0004743 3300053077 Bacteria 7882
136 Ga0495601_0347781 3300053077 Bacteria 964
137 Ga0495612_0083810 3300053078 Unclassified 1342
138 Ga0495655_0000016 3300053083 Bacteria 50674
139 Ga0495619_0000015 3300053085 Bacteria 252787
140 Ga0495619_0000372 3300053085 Bacteria 30832
141 Ga0495619_0006880 3300053085 Bacteria 7189
142 Ga0495619_0685152 3300053085 Bacteria 697
143 Ga0500628_000027 3300053129 Bacteria 60626
144 Ga0070683_100049345
145 JGI24740J21852_10003290
146 JGI24034J26672_10001295
147 Ga0068869_100049440
148 Ga0070691_10000010
149 Ga0070671_100034729
150 Ga0070674_100000016
151 Ga0070710_10590428
152 Ga0070711_100009636
153 Ga0070685_10003014
154 Ga0070679_100004239
155 Ga0070684_101914599
156 Ga0068853_100415758
157 Ga0070686_101458561
158 Ga0070695_100063325
159 Ga0070665_100832877
160 Ga0068857_100424587
161 Ga0068856_100274163
162 Ga0068866_10000148
163 Ga0068866_10050714
164 Ga0068863_100058765
165 Ga0068863_100082388
166 Ga0068860_100221452
167 Ga0070716_100070104
168 Ga0075435_100762352
169 Ga0105245_10362584
170 Ga0105245_10763615
171 Ga0105242_10003532
172 Ga0105242_10005935
173 Ga0105242_10040376
174 Ga0157347_1027589
175 Ga0157370_10019858
176 Ga0157370_10424791
177 Ga0157375_10298983
178 Ga0157375_11170588
179 Ga0157375_13599460
180 Ga0163163_11454918
181 Ga0157380_10000024
182 Ga0157379_11137884
183 Ga0157376_10083529
184 Ga0207642_10000051
185 Ga0207642_10015731
186 Ga0207710_10001475
187 Ga0207647_10178154
188 Ga0207693_10846729
189 Ga0207663_10001468
190 Ga0207687_10026252
191 Ga0207686_10000271
192 Ga0207686_10001838
193 Ga0207686_10307873
194 Ga0207669_10000064
195 Ga0207665_10119550
196 Ga0207689_10246888
197 Ga0207661_10167919
198 Ga0207668_10269346
199 Ga0207639_10131308
200 Ga0207678_10080253
201 Ga0207641_10007515
202 Ga0207641_10553067
203 Ga0207648_10001998
204 Ga0268266_10773337
205 Ga0268265_11999810
206 Ga0268264_10143734
207 Ga0265338_10000047
208 Ga0265324_10081504
209 Ga0307511_10212500
210 Ga0265331_10185724
211 Ga0265316_10589097
212 Ga0265342_10054376
213 Ga0451853_2140586
214 Ga0466967_0000008
215 Ga0495592_0131488
216 Ga0495603_0000044
217 Ga0495629_0001046
218 Ga0495629_0001573
219 Ga0495629_0400504
220 Ga0495582_0000307
221 Ga0495594_0000217
222 Ga0495606_0000219
223 Ga0495608_0557185
224 Ga0495618_0393981
225 Ga0495628_0010777
226 Ga0495630_0004625
227 Ga0495630_0206560
228 Ga0495640_0103474
229 Ga0495621_0025305
230 Ga0495656_0002074
231 Ga0495634_0000030
232 Ga0495634_0194730
233 Ga0495623_0258301
234 Ga0495658_0000190
235 Ga0495658_0007818
236 Ga0495676_0036209
237 Ga0495686_0081354
238 Ga0495614_0426887
239 Ga0496100_0000046
240 Ga0496101_0000124
241 Ga0496102_0000404
242 Ga0496103_0000001
243 Ga0496103_0083664
244 Ga0496104_0000002
245 Ga0496104_0000139
246 Ga0496104_0479713
247 Ga0496105_0000001
248 Ga0496105_0000054
249 Ga0496106_0000059
250 Ga0496107_0000018
251 Ga0496108_0002243
252 Ga0496108_0034683
253 Ga0496109_0000291
254 Ga0496109_0009757
255 Ga0496109_0065700
256 Ga0496110_0000476
257 Ga0496110_0021001
258 Ga0496110_0319787
259 Ga0496111_0006837
260 Ga0496111_0007693
261 Ga0496111_0221593
262 Ga0496112_0000002
263 Ga0496113_0026877
264 Ga0496113_0214717
265 Ga0496114_0000043
266 Ga0496114_0343345
267 Ga0496115_0000211
268 Ga0496115_0072353
269 Ga0496118_0473536
270 Ga0496119_0034424
271 Ga0496120_0027417
272 Ga0496124_0090556
273 Ga0501046_1037774
274 Ga0501047_0897723
275 Ga0501070_0016779
276 Ga0501070_0039167
277 Ga0501072_0376420
278 Ga0495601_0004743
279 Ga0495601_0347781
280 Ga0495612_0083810
281 Ga0495655_0000016
282 Ga0495619_0000015
283 Ga0495619_0000372
284 Ga0495619_0006880
285 Ga0495619_0685152
286 Ga0500628_000027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

9

98

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a56-assembly1.cif.gz_A coenzyme a-persulfide reductase (coapr) from enterococcus faecalis 0.9509 7 98
8a56-assembly1.cif.gz_B coenzyme a-persulfide reductase (coapr) from enterococcus faecalis 0.9478 7 97
3hix-assembly3.cif.gz_C crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.9398 22 105
3gk5-assembly1.cif.gz_A crystal structure of rhodanese-related protein (tvg0868615) from thermoplasma volcanium, northeast structural genomics consortium target tvr109a 0.9369 8 104
3hix-assembly1.cif.gz_A crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.9369 22 105
ID Description Score Start End Superfamily
3gk5A00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9369 8 104 3.40.250.10
af_Q2FY36_20_124_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9319 7 97 3.40.250.10
af_O08446_114_219_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9299 10 105 3.40.250.10
3icsA03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9224 7 100 3.40.250.10
af_Q60359_91_222_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9219 8 101 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A512I9B5-F1-model_v4 Sulfurtransferase 0.9855 23 105 GO:0016740
AF-A0A7W0UAR0-F1-model_v4 Rhodanese-like domain-containing protein 0.9837 22 113
AF-A0A7Y9YAK1-F1-model_v4 Rhodanese-related sulfurtransferase/glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9827 8 105 GO:0004792
GO:0006749
GO:0016787
GO:0050313
GO:0070813
AF-A0A2G9N3U6-F1-model_v4 Rhodanese domain-containing protein 0.9822 7 99
AF-A0A3M1NSC0-F1-model_v4 MBL fold metallo-hydrolase 0.9813 22 104 GO:0006749
GO:0016787
GO:0050313
GO:0070813

Map