F188174
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 143 | 93 | 286 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100000002|Ga0068855_100000002101 |
| Length | 316 |
| Sequence | MAKKAELLEAAKKLGLELSEKNTIKEIEEAIQATGTTVAAEELAVLEDTPVAKAGKRSAKAISGDTTPTDSEAPAAKKGPRPVTRPLIERRGKNYRKVAELVDATKFYNLADAIELASKTSPSKFDASVEVHVRLNVDPRQADQNIRATVSLPNGTGKTVRVAVFTPEADHKAAKAAGADVVGDETFLAQLDKEEINFDILIATPQFMPRLGKYARLLGPRGLMPNPKSGSVATDVAKAVTEAKAGKVEYRVDKQAIVHLSIGKVSFGAAKLAENAKSFFDSLTSQKPTSIKGSYVKSISVSTTQGPGIKVENFIN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 12 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 13 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 15 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 16 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 17 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 18 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 19 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 21 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 26 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 27 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 46 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 47 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 48 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 49 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 50 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 51 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 52 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 53 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 54 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 55 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 56 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 57 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 58 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 59 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 60 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 61 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 62 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 63 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 64 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 68 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 69 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 70 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 71 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 72 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 73 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 74 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 75 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 76 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 77 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 78 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 79 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 80 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 81 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 82 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 83 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 84 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 85 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 86 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 87 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 88 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 89 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 90 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 91 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 92 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 93 | 3300053738 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 29.37 |
| Nodule | 0 |
| Rhizoplane | 0.7 |
| Rhizosphere | 65.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068855_100000002 | 3300005563 | Bacteria | 616881 |
| 2 | rootH1_10010401 | 3300003316 | Bacteria | 137135 |
| 3 | rootH2_10004265 | 3300003320 | Bacteria | 78343 |
| 4 | rootH1_10018225 | 3300003323 | Bacteria | 53223 |
| 5 | rootH1_10207114 | 3300003323 | Bacteria | 1936 |
| 6 | Ga0070670_100337085 | 3300005331 | Bacteria | 1323 |
| 7 | Ga0070660_100000848 | 3300005339 | Bacteria | 20334 |
| 8 | Ga0070661_100147280 | 3300005344 | Unclassified | 1778 |
| 9 | Ga0070681_10056014 | 3300005458 | Bacteria | 3924 |
| 10 | Ga0070704_100052581 | 3300005549 | Bacteria | 2874 |
| 11 | Ga0068855_100000107 | 3300005563 | Bacteria | 103580 |
| 12 | Ga0068855_100023622 | 3300005563 | Bacteria | 7364 |
| 13 | Ga0070664_100164789 | 3300005564 | Bacteria | 1963 |
| 14 | Ga0068854_100224706 | 3300005578 | Bacteria | 1487 |
| 15 | Ga0068852_100000001 | 3300005616 | Bacteria | 716526 |
| 16 | Ga0068852_100166197 | 3300005616 | Bacteria | 2064 |
| 17 | Ga0081455_10000001 | 3300005937 | Bacteria | 603871 |
| 18 | Ga0075365_10000028 | 3300006038 | Bacteria | 58142 |
| 19 | Ga0075365_10000045 | 3300006038 | Bacteria | 40602 |
| 20 | Ga0075365_10000936 | 3300006038 | Bacteria | 12354 |
| 21 | Ga0075365_10000953 | 3300006038 | Bacteria | 12275 |
| 22 | Ga0075368_10000415 | 3300006042 | Bacteria | 12543 |
| 23 | Ga0075363_100003445 | 3300006048 | Bacteria | 6724 |
| 24 | Ga0075364_10000046 | 3300006051 | Bacteria | 43174 |
| 25 | Ga0075364_10003156 | 3300006051 | Bacteria | 9325 |
| 26 | Ga0075364_10030292 | 3300006051 | Unclassified | 3473 |
| 27 | Ga0075367_10000327 | 3300006178 | Bacteria | 16833 |
| 28 | Ga0097621_100000003 | 3300006237 | Bacteria | 164830 |
| 29 | Ga0068871_100000017 | 3300006358 | Bacteria | 91144 |
| 30 | Ga0105240_10000004 | 3300009093 | Bacteria | 708156 |
| 31 | Ga0105240_10003473 | 3300009093 | Bacteria | 24451 |
| 32 | Ga0105240_10003896 | 3300009093 | Bacteria | 23046 |
| 33 | Ga0105241_10008632 | 3300009174 | Bacteria | 7489 |
| 34 | Ga0105237_10000001 | 3300009545 | Bacteria | 1009213 |
| 35 | Ga0105237_10000002 | 3300009545 | Bacteria | 702357 |
| 36 | Ga0105237_10095290 | 3300009545 | Bacteria | 2965 |
| 37 | Ga0105238_10001853 | 3300009551 | Bacteria | 21198 |
| 38 | Ga0105032_100001 | 3300009979 | Bacteria | 472394 |
| 39 | Ga0105032_100065 | 3300009979 | Bacteria | 11981 |
| 40 | Ga0105032_100605 | 3300009979 | Unclassified | 3509 |
| 41 | Ga0105028_101581 | 3300009993 | Bacteria | 2392 |
| 42 | Ga0105239_10061240 | 3300010375 | Bacteria | 4130 |
| 43 | Ga0157371_10016539 | 3300013102 | Bacteria | 5501 |
| 44 | Ga0157371_10065480 | 3300013102 | Bacteria | 2574 |
| 45 | Ga0157370_10014701 | 3300013104 | Bacteria | 7995 |
| 46 | Ga0157369_10000009 | 3300013105 | Bacteria | 303674 |
| 47 | Ga0157369_10000469 | 3300013105 | Bacteria | 53574 |
| 48 | Ga0157369_10038470 | 3300013105 | Bacteria | 5230 |
| 49 | Ga0157369_10126130 | 3300013105 | Bacteria | 2713 |
| 50 | Ga0157374_10164616 | 3300013296 | Bacteria | 2161 |
| 51 | Ga0157372_10000002 | 3300013307 | Bacteria | 687862 |
| 52 | Ga0157372_10000008 | 3300013307 | Bacteria | 305449 |
| 53 | Ga0157372_10008204 | 3300013307 | Bacteria | 11100 |
| 54 | Ga0157372_10125569 | 3300013307 | Bacteria | 2950 |
| 55 | Ga0157377_10012640 | 3300014745 | Bacteria | 4249 |
| 56 | Ga0207695_10000009 | 3300025913 | Bacteria | 1034276 |
| 57 | Ga0207695_10003269 | 3300025913 | Bacteria | 23038 |
| 58 | Ga0207695_10006895 | 3300025913 | Bacteria | 14613 |
| 59 | Ga0207671_10000003 | 3300025914 | Bacteria | 1065461 |
| 60 | Ga0207671_10000008 | 3300025914 | Bacteria | 798229 |
| 61 | Ga0207671_10072385 | 3300025914 | Bacteria | 2572 |
| 62 | Ga0207657_10043300 | 3300025919 | Bacteria | 3966 |
| 63 | Ga0207694_10023010 | 3300025924 | Bacteria | 4729 |
| 64 | Ga0207679_10137593 | 3300025945 | Bacteria | 1969 |
| 65 | Ga0207667_10000005 | 3300025949 | Bacteria | 715503 |
| 66 | Ga0207667_10000128 | 3300025949 | Bacteria | 116173 |
| 67 | Ga0207667_10048830 | 3300025949 | Bacteria | 4473 |
| 68 | Ga0207640_10007698 | 3300025981 | Bacteria | 5954 |
| 69 | Ga0207674_10017172 | 3300026116 | Bacteria | 7899 |
| 70 | Ga0207674_10072349 | 3300026116 | Bacteria | 3464 |
| 71 | Ga0207698_10000001 | 3300026142 | Bacteria | 625389 |
| 72 | Ga0207698_10585414 | 3300026142 | Bacteria | 1098 |
| 73 | Ga0209813_10000197 | 3300027866 | Bacteria | 18622 |
| 74 | Ga0209974_10023331 | 3300027876 | Bacteria | 2047 |
| 75 | Ga0314311_1060244 | 3300030733 | Bacteria | 4775 |
| 76 | Ga0316179_1000887 | 3300030734 | Bacteria | 22050 |
| 77 | Ga0316178_1157202 | 3300030735 | Unclassified | 1645 |
| 78 | Ga0316180_1024638 | 3300030736 | Bacteria | 2106 |
| 79 | Ga0316183_1020987 | 3300030742 | Bacteria | 11927 |
| 80 | Ga0316183_1033544 | 3300030742 | Bacteria | 8423 |
| 81 | Ga0316183_1131937 | 3300030742 | Bacteria | 7071 |
| 82 | Ga0316183_1162140 | 3300030742 | Bacteria | 1850 |
| 83 | Ga0316181_1063761 | 3300030744 | Bacteria | 284591 |
| 84 | Ga0316182_1033270 | 3300030745 | Bacteria | 11693 |
| 85 | Ga0316182_1071002 | 3300030745 | Bacteria | 6065 |
| 86 | Ga0316182_1366652 | 3300030745 | Bacteria | 24336 |
| 87 | Ga0316182_1395767 | 3300030745 | Bacteria | 4569 |
| 88 | Ga0307516_10057516 | 3300031730 | Bacteria | 3788 |
| 89 | Ga0307406_10000001 | 3300031901 | Bacteria | 638191 |
| 90 | Ga0307406_10001410 | 3300031901 | Bacteria | 13351 |
| 91 | Ga0395905_0002235 | 3300037471 | Bacteria | 21825 |
| 92 | Ga0395901_0038117 | 3300038443 | Bacteria | 4972 |
| 93 | Ga0439461_0000647 | 3300041410 | Bacteria | 5019 |
| 94 | Ga0439432_038909 | 3300042006 | Bacteria | 1513 |
| 95 | Ga0450903_002774 | 3300042138 | Bacteria | 3087 |
| 96 | Ga0450906_002406 | 3300042145 | Bacteria | 4094 |
| 97 | Ga0439446_0002905 | 3300042156 | Bacteria | 4182 |
| 98 | Ga0439434_0002308 | 3300042435 | Bacteria | 5544 |
| 99 | Ga0450918_004540 | 3300042531 | Bacteria | 2526 |
| 100 | Ga0466965_0003110 | 3300044683 | Bacteria | 7235 |
| 101 | Ga0495638_0000070 | 3300046460 | Bacteria | 166954 |
| 102 | Ga0495638_0000189 | 3300046460 | Bacteria | 93205 |
| 103 | Ga0495597_0012995 | 3300046542 | Bacteria | 3998 |
| 104 | Ga0495660_0000090 | 3300046810 | Bacteria | 98309 |
| 105 | Ga0496115_0000007 | 3300048918 | Bacteria | 244991 |
| 106 | Ga0496124_0029993 | 3300048927 | Bacteria | 4836 |
| 107 | Ga0501034_0000090 | 3300049571 | Bacteria | 165117 |
| 108 | Ga0501034_0007677 | 3300049571 | Bacteria | 11480 |
| 109 | Ga0501034_0045553 | 3300049571 | Bacteria | 4432 |
| 110 | Ga0501037_0000001 | 3300049573 | Bacteria | 753276 |
| 111 | Ga0501043_0314482 | 3300049579 | Bacteria | 1195 |
| 112 | Ga0501080_0510080 | 3300049742 | Bacteria | 1074 |
| 113 | nmdc:mga00v17_10783_c1 | 3300050491 | Bacteria | 5005 |
| 114 | nmdc:mga00v17_2567_c1 | 3300050491 | Bacteria | 9325 |
| 115 | nmdc:mga00v17_30_c1 | 3300050491 | Bacteria | 88199 |
| 116 | nmdc:mga0yw44_12_c1 | 3300050492 | Bacteria | 128020 |
| 117 | nmdc:mga0yw44_1_c1 | 3300050492 | Bacteria | 702221 |
| 118 | nmdc:mga0yw44_32_c1 | 3300050492 | Bacteria | 50887 |
| 119 | nmdc:mga0yw44_41791_c1 | 3300050492 | Bacteria | 2731 |
| 120 | nmdc:mga0yw44_45_c1 | 3300050492 | Bacteria | 41778 |
| 121 | nmdc:mga0yw44_6_c1 | 3300050492 | Bacteria | 272478 |
| 122 | nmdc:mga04h51_159_c1 | 3300050495 | Bacteria | 19324 |
| 123 | nmdc:mga07m45_27450_c1 | 3300050496 | Bacteria | 3136 |
| 124 | Ga0500643_003058 | 3300053087 | Bacteria | 8243 |
| 125 | Ga0500646_0000003 | 3300053090 | Bacteria | 144737 |
| 126 | Ga0500646_0004890 | 3300053090 | Bacteria | 3396 |
| 127 | Ga0500583_0000300 | 3300053092 | Bacteria | 17148 |
| 128 | Ga0500651_0000001 | 3300053093 | Bacteria | 529808 |
| 129 | Ga0500651_0000192 | 3300053093 | Bacteria | 39055 |
| 130 | Ga0500641_0000001 | 3300053096 | Bacteria | 1115973 |
| 131 | Ga0500650_0012029 | 3300053098 | Bacteria | 3589 |
| 132 | Ga0500562_000001 | 3300053108 | Bacteria | 1178987 |
| 133 | Ga0500569_000013 | 3300053109 | Bacteria | 50700 |
| 134 | Ga0500594_0000004 | 3300053118 | Bacteria | 174508 |
| 135 | Ga0500652_000001 | 3300053131 | Bacteria | 946868 |
| 136 | Ga0500655_000401 | 3300053133 | Bacteria | 9181 |
| 137 | Ga0500568_0007798 | 3300053139 | Bacteria | 5215 |
| 138 | Ga0500577_0000147 | 3300053142 | Bacteria | 17244 |
| 139 | Ga0500577_0022737 | 3300053142 | Bacteria | 2084 |
| 140 | Ga0500588_0000062 | 3300053146 | Bacteria | 17047 |
| 141 | Ga0500616_0000012 | 3300053153 | Bacteria | 681798 |
| 142 | Ga0500570_006410 | 3300053724 | Bacteria | 6394 |
| 143 | Ga0500613_001105 | 3300053738 | Bacteria | 1772 |
| 144 | Ga0068855_100000002 | |||
| 145 | rootH1_10010401 | |||
| 146 | rootH2_10004265 | |||
| 147 | rootH1_10018225 | |||
| 148 | rootH1_10207114 | |||
| 149 | Ga0070670_100337085 | |||
| 150 | Ga0070660_100000848 | |||
| 151 | Ga0070661_100147280 | |||
| 152 | Ga0070681_10056014 | |||
| 153 | Ga0070704_100052581 | |||
| 154 | Ga0068855_100000107 | |||
| 155 | Ga0068855_100023622 | |||
| 156 | Ga0070664_100164789 | |||
| 157 | Ga0068854_100224706 | |||
| 158 | Ga0068852_100000001 | |||
| 159 | Ga0068852_100166197 | |||
| 160 | Ga0081455_10000001 | |||
| 161 | Ga0075365_10000028 | |||
| 162 | Ga0075365_10000045 | |||
| 163 | Ga0075365_10000936 | |||
| 164 | Ga0075365_10000953 | |||
| 165 | Ga0075368_10000415 | |||
| 166 | Ga0075363_100003445 | |||
| 167 | Ga0075364_10000046 | |||
| 168 | Ga0075364_10003156 | |||
| 169 | Ga0075364_10030292 | |||
| 170 | Ga0075367_10000327 | |||
| 171 | Ga0097621_100000003 | |||
| 172 | Ga0068871_100000017 | |||
| 173 | Ga0105240_10000004 | |||
| 174 | Ga0105240_10003473 | |||
| 175 | Ga0105240_10003896 | |||
| 176 | Ga0105241_10008632 | |||
| 177 | Ga0105237_10000001 | |||
| 178 | Ga0105237_10000002 | |||
| 179 | Ga0105237_10095290 | |||
| 180 | Ga0105238_10001853 | |||
| 181 | Ga0105032_100001 | |||
| 182 | Ga0105032_100065 | |||
| 183 | Ga0105032_100605 | |||
| 184 | Ga0105028_101581 | |||
| 185 | Ga0105239_10061240 | |||
| 186 | Ga0157371_10016539 | |||
| 187 | Ga0157371_10065480 | |||
| 188 | Ga0157370_10014701 | |||
| 189 | Ga0157369_10000009 | |||
| 190 | Ga0157369_10000469 | |||
| 191 | Ga0157369_10038470 | |||
| 192 | Ga0157369_10126130 | |||
| 193 | Ga0157374_10164616 | |||
| 194 | Ga0157372_10000002 | |||
| 195 | Ga0157372_10000008 | |||
| 196 | Ga0157372_10008204 | |||
| 197 | Ga0157372_10125569 | |||
| 198 | Ga0157377_10012640 | |||
| 199 | Ga0207695_10000009 | |||
| 200 | Ga0207695_10003269 | |||
| 201 | Ga0207695_10006895 | |||
| 202 | Ga0207671_10000003 | |||
| 203 | Ga0207671_10000008 | |||
| 204 | Ga0207671_10072385 | |||
| 205 | Ga0207657_10043300 | |||
| 206 | Ga0207694_10023010 | |||
| 207 | Ga0207679_10137593 | |||
| 208 | Ga0207667_10000005 | |||
| 209 | Ga0207667_10000128 | |||
| 210 | Ga0207667_10048830 | |||
| 211 | Ga0207640_10007698 | |||
| 212 | Ga0207674_10017172 | |||
| 213 | Ga0207674_10072349 | |||
| 214 | Ga0207698_10000001 | |||
| 215 | Ga0207698_10585414 | |||
| 216 | Ga0209813_10000197 | |||
| 217 | Ga0209974_10023331 | |||
| 218 | Ga0314311_1060244 | |||
| 219 | Ga0316179_1000887 | |||
| 220 | Ga0316178_1157202 | |||
| 221 | Ga0316180_1024638 | |||
| 222 | Ga0316183_1020987 | |||
| 223 | Ga0316183_1033544 | |||
| 224 | Ga0316183_1131937 | |||
| 225 | Ga0316183_1162140 | |||
| 226 | Ga0316181_1063761 | |||
| 227 | Ga0316182_1033270 | |||
| 228 | Ga0316182_1071002 | |||
| 229 | Ga0316182_1366652 | |||
| 230 | Ga0316182_1395767 | |||
| 231 | Ga0307516_10057516 | |||
| 232 | Ga0307406_10000001 | |||
| 233 | Ga0307406_10001410 | |||
| 234 | Ga0395905_0002235 | |||
| 235 | Ga0395901_0038117 | |||
| 236 | Ga0439461_0000647 | |||
| 237 | Ga0439432_038909 | |||
| 238 | Ga0450903_002774 | |||
| 239 | Ga0450906_002406 | |||
| 240 | Ga0439446_0002905 | |||
| 241 | Ga0439434_0002308 | |||
| 242 | Ga0450918_004540 | |||
| 243 | Ga0466965_0003110 | |||
| 244 | Ga0495638_0000070 | |||
| 245 | Ga0495638_0000189 | |||
| 246 | Ga0495597_0012995 | |||
| 247 | Ga0495660_0000090 | |||
| 248 | Ga0496115_0000007 | |||
| 249 | Ga0496124_0029993 | |||
| 250 | Ga0501034_0000090 | |||
| 251 | Ga0501034_0007677 | |||
| 252 | Ga0501034_0045553 | |||
| 253 | Ga0501037_0000001 | |||
| 254 | Ga0501043_0314482 | |||
| 255 | Ga0501080_0510080 | |||
| 256 | nmdc:mga00v17_10783_c1 | |||
| 257 | nmdc:mga00v17_2567_c1 | |||
| 258 | nmdc:mga00v17_30_c1 | |||
| 259 | nmdc:mga0yw44_12_c1 | |||
| 260 | nmdc:mga0yw44_1_c1 | |||
| 261 | nmdc:mga0yw44_32_c1 | |||
| 262 | nmdc:mga0yw44_41791_c1 | |||
| 263 | nmdc:mga0yw44_45_c1 | |||
| 264 | nmdc:mga0yw44_6_c1 | |||
| 265 | nmdc:mga04h51_159_c1 | |||
| 266 | nmdc:mga07m45_27450_c1 | |||
| 267 | Ga0500643_003058 | |||
| 268 | Ga0500646_0000003 | |||
| 269 | Ga0500646_0004890 | |||
| 270 | Ga0500583_0000300 | |||
| 271 | Ga0500651_0000001 | |||
| 272 | Ga0500651_0000192 | |||
| 273 | Ga0500641_0000001 | |||
| 274 | Ga0500650_0012029 | |||
| 275 | Ga0500562_000001 | |||
| 276 | Ga0500569_000013 | |||
| 277 | Ga0500594_0000004 | |||
| 278 | Ga0500652_000001 | |||
| 279 | Ga0500655_000401 | |||
| 280 | Ga0500568_0007798 | |||
| 281 | Ga0500577_0000147 | |||
| 282 | Ga0500577_0022737 | |||
| 283 | Ga0500588_0000062 | |||
| 284 | Ga0500616_0000012 | |||
| 285 | Ga0500570_006410 | |||
| 286 | Ga0500613_001105 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vpl-assembly1.cif.gz_A | the structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii | 0.9375 | 84 | 305 |
| 4wpo-assembly1.cif.gz_AC | crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state | 0.9321 | 84 | 305 |
| 2ov7-assembly3.cif.gz_C | the first domain of the ribosomal protein l1 from thermus thermophilus | 0.9218 | 92 | 305 |
| 6wdj-assembly1.cif.gz_a | cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (non-cognate structure v-a1) | 0.9209 | 84 | 305 |
| 4wpo-assembly1.cif.gz_AC | crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state | 0.9192 | 84 | 305 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.95 | 153 | 239 | 3.40.50.790 |
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9397 | 153 | 239 | 3.40.50.790 |
| 2wrrC01 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9237 | 96 | 305 | 3.30.190.20 |
| af_Q8IBY1_171_256_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9187 | 151 | 237 | 3.40.50.790 |
| 2vplC01 | Special;Helix non-globular;Arc Repressor Mutant, subunit A;50S ribosomal protein L1; Chain A, Domain 1 | 0.9167 | 84 | 114 | 6.10.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C1DJ35-F1-model_v4 | Large ribosomal subunit protein uL1 (50S ribosomal protein L1) | 0.8902 | 139 | 306 |
GO:0003735
GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A1R0H960-F1-model_v4 | 50S ribosomal protein L1 | 0.8796 | 121 | 254 |
GO:0005840
GO:1990904 |
| AF-A0A7C1DJ35-F1-model_v4 | Large ribosomal subunit protein uL1 (50S ribosomal protein L1) | 0.84 | 139 | 306 |
GO:0003735
GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-F0V938-F1-model_v4 | Ribosomal protein L1, related | 0.8322 | 117 | 305 |
GO:0005840
GO:1990904 |
| AF-A0A1R0H960-F1-model_v4 | 50S ribosomal protein L1 | 0.8277 | 121 | 254 |
GO:0005840
GO:1990904 |