F189062

General Info

Members Datasets Scaffolds Average Seq Length
143 113 286 383

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1000101|Ga0265337_10001013
Length 441
Sequence VARRKRPINAGVPAPKPEEAGEKAAAQATPVLPKKAVEEPVTETLAPIAPEAPKRRRKPIPLALKLIAGTAKPGAAAPATGKGPTQANAPAEEASAELGYPAFATKNTTRIGGEDSAANAAGAALATFPSATRRERPIAVSLVDEDDWQGAIAASALMALPVRAPVLLSTGGGLPDPTAKAFDALEPLGSGATLGTQAFVVGDVATPSGLLHVKHIKAGAPADTAAAIERVRDELFGEPKHVVIASADKPGFAMPAAAWAARSGDPVLFSASDKLPAATAKAIALHPEVPIYILGPTSAISSDVEAEIAAIDPSVHRVSGEDPVSNAIALARYSDGDFGWNVNDPGHGFVIARSDAPLDAAAAAPLSAAGTWGPLLLTDSADTLPDALRGYLLDVKPGYTTDPTRAFYNHVWVIGDQEAIDVNQQAEIDHLAELTKIGGQP

Samples

Sample ID Description Type Environment
1 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
55 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
72 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
75 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
76 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
77 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
78 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
79 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
80 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
81 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
82 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
83 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
87 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
113 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 15.38
Rhizosphere 82.52
Stem 0
Stem Tuber 0
Unclassified 4.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265337_1000101 3300028556 Bacteria 42173
2 JGI24748J21848_1000482 3300002074 Bacteria 4378
3 rootH2_10042623 3300003320 Bacteria 2599
4 Ga0070677_10000376 3300005333 Bacteria 15750
5 Ga0070680_100057674 3300005336 Unclassified 3175
6 Ga0068868_100000104 3300005338 Bacteria 52249
7 Ga0070691_10000275 3300005341 Bacteria 17919
8 Ga0070659_100052858 3300005366 Bacteria 3196
9 Ga0070662_100000001 3300005457 Bacteria 317995
10 Ga0070681_10057397 3300005458 Unclassified 3873
11 Ga0068867_100000350 3300005459 Bacteria 30621
12 Ga0070679_100000258 3300005530 Bacteria 44384
13 Ga0068853_100004703 3300005539 Bacteria 10595
14 Ga0070693_100007595 3300005547 Bacteria 5307
15 Ga0070665_100000022 3300005548 Bacteria 379286
16 Ga0068856_100022890 3300005614 Bacteria 6076
17 Ga0068864_100000043 3300005618 Bacteria 162928
18 Ga0068863_100000229 3300005841 Bacteria 59324
19 Ga0068863_100086352 3300005841 Bacteria 2973
20 Ga0068858_100000017 3300005842 Bacteria 186913
21 Ga0068858_100000140 3300005842 Bacteria 76446
22 Ga0068860_100001002 3300005843 Bacteria 31259
23 Ga0075433_10000553 3300006852 Bacteria 24618
24 Ga0075433_10041888 3300006852 Bacteria 3970
25 Ga0105245_10000330 3300009098 Bacteria 44516
26 Ga0105245_10004397 3300009098 Bacteria 12467
27 Ga0105247_10003411 3300009101 Bacteria 10384
28 Ga0105242_10000139 3300009176 Bacteria 52585
29 Ga0105242_10000264 3300009176 Bacteria 41690
30 Ga0105238_10000016 3300009551 Bacteria 236218
31 Ga0105249_10000054 3300009553 Bacteria 162883
32 Ga0157370_10029155 3300013104 Bacteria 5420
33 Ga0157374_10000242 3300013296 Bacteria 50857
34 Ga0157374_10007290 3300013296 Bacteria 9426
35 Ga0157378_10027476 3300013297 Bacteria 5021
36 Ga0157375_10000885 3300013308 Bacteria 25959
37 Ga0157380_10002261 3300014326 Bacteria 12948
38 Ga0157379_10051807 3300014968 Bacteria 3665
39 Ga0207682_10001253 3300025893 Bacteria 11732
40 Ga0207685_10000012 3300025905 Bacteria 189900
41 Ga0207707_10028417 3300025912 Bacteria 4889
42 Ga0207652_10000196 3300025921 Bacteria 63727
43 Ga0207694_10000012 3300025924 Bacteria 411218
44 Ga0207687_10000094 3300025927 Bacteria 64753
45 Ga0207687_10001127 3300025927 Bacteria 18187
46 Ga0207690_10017239 3300025932 Bacteria 4406
47 Ga0207706_10000003 3300025933 Bacteria 345011
48 Ga0207686_10000035 3300025934 Bacteria 130483
49 Ga0207686_10000242 3300025934 Bacteria 41739
50 Ga0207712_10000032 3300025961 Bacteria 210628
51 Ga0207677_10000479 3300026023 Bacteria 26103
52 Ga0207703_10000020 3300026035 Bacteria 251603
53 Ga0207703_10000030 3300026035 Bacteria 199014
54 Ga0207639_10001603 3300026041 Bacteria 15209
55 Ga0207678_10129237 3300026067 Bacteria 2154
56 Ga0207708_10070627 3300026075 Bacteria 2674
57 Ga0207702_10005046 3300026078 Bacteria 11593
58 Ga0207641_10001796 3300026088 Bacteria 20626
59 Ga0207641_10003837 3300026088 Bacteria 13162
60 Ga0207641_10230599 3300026088 Unclassified 1721
61 Ga0207648_10001072 3300026089 Bacteria 30645
62 Ga0207676_10000042 3300026095 Bacteria 163475
63 Ga0268266_10000029 3300028379 Bacteria 424015
64 Ga0268264_10006035 3300028381 Bacteria 10244
65 Ga0265326_10000033 3300028558 Bacteria 91972
66 Ga0265322_10000005 3300028654 Bacteria 246112
67 Ga0265324_10000207 3300029957 Bacteria 44991
68 Ga0265332_10006852 3300031238 Bacteria 5165
69 Ga0265328_10008314 3300031239 Bacteria 4286
70 Ga0265320_10000010 3300031240 Bacteria 250501
71 Ga0265329_10009430 3300031242 Bacteria 3645
72 Ga0265331_10000869 3300031250 Bacteria 24602
73 Ga0265327_10000040 3300031251 Bacteria 291052
74 Ga0265316_10020010 3300031344 Bacteria 5709
75 Ga0265314_10000208 3300031711 Bacteria 86855
76 Ga0265342_10015497 3300031712 Bacteria 5011
77 Ga0373937_0038588 3300036401 Bacteria 4352
78 Ga0466963_0000548 3300044694 Bacteria 17637
79 Ga0466967_0394174 3300045976 Unclassified 1346
80 Ga0495603_0000087 3300046455 Bacteria 41407
81 Ga0495629_0002590 3300046459 Bacteria 13852
82 Ga0495629_0047674 3300046459 Bacteria 3005
83 Ga0495662_0000130 3300046476 Bacteria 28303
84 Ga0495608_0000346 3300046511 Bacteria 32424
85 Ga0495608_0014780 3300046511 Bacteria 5416
86 Ga0495628_0002826 3300046516 Bacteria 15581
87 Ga0495628_0028611 3300046516 Unclassified 4526
88 Ga0495630_0068038 3300046517 Unclassified 2677
89 Ga0495644_0001343 3300046523 Bacteria 10060
90 Ga0495640_0024949 3300046533 Bacteria 4344
91 Ga0495587_0001663 3300046536 Bacteria 14848
92 Ga0495667_0000019 3300046559 Bacteria 181645
93 Ga0495656_0000600 3300046615 Bacteria 11626
94 Ga0495635_0000017 3300046663 Bacteria 195506
95 Ga0495657_0028793 3300046675 Bacteria 3902
96 Ga0495657_0042250 3300046675 Bacteria 3114
97 Ga0495647_0000028 3300046681 Bacteria 56683
98 Ga0495647_0000815 3300046681 Bacteria 9304
99 Ga0495669_0000181 3300046684 Bacteria 39486
100 Ga0495613_0000690 3300046689 Bacteria 26621
101 Ga0495624_0020467 3300046690 Bacteria 4403
102 Ga0495600_0000652 3300046809 Bacteria 18003
103 Ga0495604_0000104 3300047317 Bacteria 71390
104 Ga0495674_0000024 3300047319 Bacteria 141746
105 Ga0495676_0000935 3300047321 Bacteria 24540
106 Ga0495676_0005098 3300047321 Bacteria 12043
107 Ga0495680_0000532 3300047322 Bacteria 42837
108 Ga0495680_0000674 3300047322 Bacteria 38175
109 Ga0495680_0064120 3300047322 Bacteria 2818
110 Ga0495675_0049513 3300047444 Bacteria 2671
111 Ga0495686_0142346 3300047472 Bacteria 1414
112 Ga0495602_0116974 3300048088 Bacteria 2153
113 Ga0496100_0000006 3300048903 Bacteria 297429
114 Ga0496100_0000019 3300048903 Bacteria 149995
115 Ga0496101_0000005 3300048904 Bacteria 331455
116 Ga0496101_0000009 3300048904 Bacteria 297429
117 Ga0496103_0000001 3300048906 Bacteria 643471
118 Ga0496103_0112132 3300048906 Bacteria 1733
119 Ga0496104_0000008 3300048907 Bacteria 516976
120 Ga0496104_0000010 3300048907 Bacteria 475255
121 Ga0496105_0000003 3300048908 Bacteria 713251
122 Ga0496105_0000005 3300048908 Bacteria 475797
123 Ga0496106_0000064 3300048909 Bacteria 85019
124 Ga0496106_0000156 3300048909 Bacteria 50301
125 Ga0496107_0000002 3300048910 Bacteria 320871
126 Ga0496107_0000004 3300048910 Bacteria 297680
127 Ga0496108_0000004 3300048911 Bacteria 545055
128 Ga0496108_0000413 3300048911 Bacteria 34974
129 Ga0496109_0000031 3300048912 Bacteria 163998
130 Ga0496109_0000333 3300048912 Bacteria 44006
131 Ga0496110_0041450 3300048913 Bacteria 4018
132 Ga0496111_0026197 3300048914 Bacteria 4117
133 Ga0496113_0190387 3300048916 Bacteria 1628
134 Ga0496115_0000022 3300048918 Bacteria 164224
135 Ga0496125_0025612 3300048928 Bacteria 5398
136 Ga0501042_0025607 3300049578 Bacteria 4145
137 Ga0501075_0018515 3300049591 Bacteria 5041
138 Ga0501081_0080945 3300049743 Bacteria 2274
139 nmdc:mga0a205_1461_c1 3300050515 Bacteria 20140
140 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
141 Ga0495601_0003845 3300053077 Bacteria 8644
142 Ga0495601_0017120 3300053077 Bacteria 4398
143 Ga0500566_0012412 3300053094 Bacteria 5016
144 Ga0265337_1000101
145 JGI24748J21848_1000482
146 rootH2_10042623
147 Ga0070677_10000376
148 Ga0070680_100057674
149 Ga0068868_100000104
150 Ga0070691_10000275
151 Ga0070659_100052858
152 Ga0070662_100000001
153 Ga0070681_10057397
154 Ga0068867_100000350
155 Ga0070679_100000258
156 Ga0068853_100004703
157 Ga0070693_100007595
158 Ga0070665_100000022
159 Ga0068856_100022890
160 Ga0068864_100000043
161 Ga0068863_100000229
162 Ga0068863_100086352
163 Ga0068858_100000017
164 Ga0068858_100000140
165 Ga0068860_100001002
166 Ga0075433_10000553
167 Ga0075433_10041888
168 Ga0105245_10000330
169 Ga0105245_10004397
170 Ga0105247_10003411
171 Ga0105242_10000139
172 Ga0105242_10000264
173 Ga0105238_10000016
174 Ga0105249_10000054
175 Ga0157370_10029155
176 Ga0157374_10000242
177 Ga0157374_10007290
178 Ga0157378_10027476
179 Ga0157375_10000885
180 Ga0157380_10002261
181 Ga0157379_10051807
182 Ga0207682_10001253
183 Ga0207685_10000012
184 Ga0207707_10028417
185 Ga0207652_10000196
186 Ga0207694_10000012
187 Ga0207687_10000094
188 Ga0207687_10001127
189 Ga0207690_10017239
190 Ga0207706_10000003
191 Ga0207686_10000035
192 Ga0207686_10000242
193 Ga0207712_10000032
194 Ga0207677_10000479
195 Ga0207703_10000020
196 Ga0207703_10000030
197 Ga0207639_10001603
198 Ga0207678_10129237
199 Ga0207708_10070627
200 Ga0207702_10005046
201 Ga0207641_10001796
202 Ga0207641_10003837
203 Ga0207641_10230599
204 Ga0207648_10001072
205 Ga0207676_10000042
206 Ga0268266_10000029
207 Ga0268264_10006035
208 Ga0265326_10000033
209 Ga0265322_10000005
210 Ga0265324_10000207
211 Ga0265332_10006852
212 Ga0265328_10008314
213 Ga0265320_10000010
214 Ga0265329_10009430
215 Ga0265331_10000869
216 Ga0265327_10000040
217 Ga0265316_10020010
218 Ga0265314_10000208
219 Ga0265342_10015497
220 Ga0373937_0038588
221 Ga0466963_0000548
222 Ga0466967_0394174
223 Ga0495603_0000087
224 Ga0495629_0002590
225 Ga0495629_0047674
226 Ga0495662_0000130
227 Ga0495608_0000346
228 Ga0495608_0014780
229 Ga0495628_0002826
230 Ga0495628_0028611
231 Ga0495630_0068038
232 Ga0495644_0001343
233 Ga0495640_0024949
234 Ga0495587_0001663
235 Ga0495667_0000019
236 Ga0495656_0000600
237 Ga0495635_0000017
238 Ga0495657_0028793
239 Ga0495657_0042250
240 Ga0495647_0000028
241 Ga0495647_0000815
242 Ga0495669_0000181
243 Ga0495613_0000690
244 Ga0495624_0020467
245 Ga0495600_0000652
246 Ga0495604_0000104
247 Ga0495674_0000024
248 Ga0495676_0000935
249 Ga0495676_0005098
250 Ga0495680_0000532
251 Ga0495680_0000674
252 Ga0495680_0064120
253 Ga0495675_0049513
254 Ga0495686_0142346
255 Ga0495602_0116974
256 Ga0496100_0000006
257 Ga0496100_0000019
258 Ga0496101_0000005
259 Ga0496101_0000009
260 Ga0496103_0000001
261 Ga0496103_0112132
262 Ga0496104_0000008
263 Ga0496104_0000010
264 Ga0496105_0000003
265 Ga0496105_0000005
266 Ga0496106_0000064
267 Ga0496106_0000156
268 Ga0496107_0000002
269 Ga0496107_0000004
270 Ga0496108_0000004
271 Ga0496108_0000413
272 Ga0496109_0000031
273 Ga0496109_0000333
274 Ga0496110_0041450
275 Ga0496111_0026197
276 Ga0496113_0190387
277 Ga0496115_0000022
278 Ga0496125_0025612
279 Ga0501042_0025607
280 Ga0501075_0018515
281 Ga0501081_0080945
282 nmdc:mga0a205_1461_c1
283 nmdc:mga0a205_4_c1
284 Ga0495601_0003845
285 Ga0495601_0017120
286 Ga0500566_0012412

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04122

CW_binding_2

Cell wall binding domain 2 (CWB2)

317

424

0.75

PF04122

CW_binding_2

Cell wall binding domain 2 (CWB2)

221

305

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7acx-assembly2.cif.gz_D h/l (slph/slpl) complex from c. difficile (r7404 strain) 0.7791 51 348
5j72-assembly2.cif.gz_B cwp6 from clostridium difficile 0.7732 41 348
7qgq-assembly1.cif.gz_U extended h/l (slph/slpl) complex from c. difficile (cd630 strain) fit into r20291 s-layer negative stain map 0.7604 54 348
5j6q-assembly1.cif.gz_A cwp8 from clostridium difficile 0.7578 50 349
7acz-assembly2.cif.gz_D rdeltad2 h/l (lmw slp/hmw slp) complex from c. difficile slpa (r20291 strain) 0.7515 51 348
ID Description Score Start End Superfamily
af_Q58165_27_122_3.40.50.12090 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7341 157 250 3.40.50.12090
af_Q58165_27_122_3.40.50.12090 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7157 157 250 3.40.50.12090
af_Q9VL76_1_340_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.6065 154 238 3.40.1360.10
4qriB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5771 139 234 3.40.50.2020
af_P9WNS3_497_621_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5523 152 237 3.40.50.920
ID Description Score Start End GO Terms
AF-A0A6N7YF45-F1-model_v4 Uncharacterized protein 0.9536 79 227
AF-A0A7V8ZJE9-F1-model_v4 Cell wall-binding repeat-containing protein 0.9345 45 347
AF-A0A6N7YF45-F1-model_v4 Uncharacterized protein 0.9293 79 227
AF-A0A538K656-F1-model_v4 Cell wall-binding repeat-containing protein 0.9287 74 347
AF-A0A1M4Y5G0-F1-model_v4 ArsR family transcriptional regulator 0.9113 53 347 GO:0030288

Map