F189796

General Info

Members Datasets Scaffolds Average Seq Length
143 91 286 82

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0046160|Ga0495672_0046160_1416_1706
Length 96
Sequence MGMAKTITIYTTTTCAYCEMVKKWLGSKGLSYNVINMDEEAPEVRQRVIEMSGAMTVPVTVVEELAEGASEPSYRDITVGWNPAKLGAAVRDMVAA

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
78 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
79 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
85 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
86 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
87 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
88 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
89 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
90 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
91 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.39
Nodule 0
Rhizoplane 0.7
Rhizosphere 88.11
Stem 0
Stem Tuber 0
Unclassified 33.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0046160 3300047320 Unclassified 2600
2 rootH2_10000244 3300003320 Bacteria 697651
3 Ga0070658_10003525 3300005327 Bacteria 12844
4 Ga0070683_100415983 3300005329 Bacteria 1282
5 Ga0070680_100245053 3300005336 Bacteria 1515
6 Ga0068868_102004473 3300005338 Unclassified 549
7 Ga0070671_100768588 3300005355 Unclassified 838
8 Ga0070713_100599635 3300005436 Bacteria 1046
9 Ga0070681_11037924 3300005458 Unclassified 740
10 Ga0068867_100081453 3300005459 Bacteria 2440
11 Ga0070679_100301821 3300005530 Bacteria 1552
12 Ga0070679_100445914 3300005530 Unclassified 1239
13 Ga0070684_100874954 3300005535 Unclassified 841
14 Ga0068853_100878741 3300005539 Bacteria 860
15 Ga0070686_101595167 3300005544 Unclassified 552
16 Ga0068855_100037222 3300005563 Bacteria 5788
17 Ga0068855_100083601 3300005563 Bacteria 3697
18 Ga0068855_100179086 3300005563 Bacteria 2397
19 Ga0068855_100216914 3300005563 Unclassified 2147
20 Ga0068855_101549114 3300005563 Unclassified 679
21 Ga0068855_101862809 3300005563 Unclassified 610
22 Ga0070664_100249474 3300005564 Unclassified 1595
23 Ga0068856_101478317 3300005614 Unclassified 693
24 Ga0068856_101798636 3300005614 Unclassified 624
25 Ga0068856_102420418 3300005614 Unclassified 532
26 Ga0068862_100014078 3300005844 Bacteria 6635
27 Ga0070717_10406067 3300006028 Bacteria 1224
28 Ga0070717_10930794 3300006028 Bacteria 791
29 Ga0075365_10999940 3300006038 Unclassified 589
30 Ga0075364_10058459 3300006051 Bacteria 2527
31 Ga0075362_10020843 3300006177 Bacteria 2743
32 Ga0075366_10000342 3300006195 Bacteria 21427
33 Ga0097621_100000003 3300006237 Bacteria 164830
34 Ga0097621_100001002 3300006237 Bacteria 19854
35 Ga0097621_101240263 3300006237 Unclassified 703
36 Ga0068871_100000013 3300006358 Bacteria 102533
37 Ga0068871_101926997 3300006358 Unclassified 562
38 Ga0075428_100074834 3300006844 Bacteria 3699
39 Ga0105240_11032551 3300009093 Bacteria 878
40 Ga0105245_10452501 3300009098 Unclassified 1293
41 Ga0105245_10512987 3300009098 Unclassified 1216
42 Ga0105245_11464210 3300009098 Bacteria 733
43 Ga0105247_10165159 3300009101 Bacteria 1468
44 Ga0105241_10000367 3300009174 Bacteria 34366
45 Ga0105241_10556227 3300009174 Unclassified 1031
46 Ga0105241_11148847 3300009174 Bacteria 733
47 Ga0105242_10133850 3300009176 Bacteria 2143
48 Ga0105242_10256925 3300009176 Bacteria 1576
49 Ga0105238_10631913 3300009551 Bacteria 1080
50 Ga0105238_10667620 3300009551 Bacteria 1050
51 Ga0105246_10310891 3300011119 Bacteria 1276
52 Ga0157373_10460323 3300013100 Bacteria 916
53 Ga0157370_10138188 3300013104 Unclassified 2270
54 Ga0157369_10089735 3300013105 Bacteria 3282
55 Ga0157369_11543443 3300013105 Bacteria 675
56 Ga0157369_12408774 3300013105 Unclassified 533
57 Ga0157374_12055915 3300013296 Unclassified 598
58 Ga0157374_12439557 3300013296 Unclassified 550
59 Ga0157372_10000194 3300013307 Bacteria 66925
60 Ga0157372_13423516 3300013307 Unclassified 504
61 Ga0163163_10059901 3300014325 Unclassified 3768
62 Ga0157377_10033136 3300014745 Unclassified 2818
63 Ga0207705_10101386 3300025909 Bacteria 2118
64 Ga0207654_10000546 3300025911 Bacteria 21515
65 Ga0207654_10269768 3300025911 Bacteria 1147
66 Ga0207654_10747956 3300025911 Unclassified 704
67 Ga0207654_10818867 3300025911 Bacteria 673
68 Ga0207660_10042451 3300025917 Bacteria 3193
69 Ga0207660_11331452 3300025917 Unclassified 583
70 Ga0207652_10101107 3300025921 Unclassified 2546
71 Ga0207652_10397982 3300025921 Unclassified 1243
72 Ga0207694_10737939 3300025924 Bacteria 831
73 Ga0207694_10975836 3300025924 Bacteria 717
74 Ga0207687_10450489 3300025927 Unclassified 1067
75 Ga0207687_11318967 3300025927 Unclassified 620
76 Ga0207700_10492674 3300025928 Bacteria 1084
77 Ga0207686_10095308 3300025934 Bacteria 1975
78 Ga0207686_11468413 3300025934 Unclassified 562
79 Ga0207661_10366306 3300025944 Bacteria 1302
80 Ga0207679_10715339 3300025945 Bacteria 909
81 Ga0207667_10031525 3300025949 Bacteria 5722
82 Ga0207667_10113402 3300025949 Bacteria 2795
83 Ga0207667_10452129 3300025949 Bacteria 1305
84 Ga0207667_11242009 3300025949 Unclassified 723
85 Ga0207658_10006571 3300025986 Bacteria 7925
86 Ga0207702_10650407 3300026078 Unclassified 1037
87 Ga0207648_10119715 3300026089 Bacteria 2314
88 Ga0207674_10353422 3300026116 Bacteria 1421
89 Ga0207683_11021203 3300026121 Unclassified 767
90 Ga0268265_10042094 3300028380 Unclassified 3386
91 Ga0265337_1006253 3300028556 Bacteria 4617
92 Ga0265326_10003292 3300028558 Bacteria 5320
93 Ga0265326_10017680 3300028558 Unclassified 2055
94 Ga0265334_10000049 3300028573 Bacteria 89091
95 Ga0265334_10004026 3300028573 Bacteria 6596
96 Ga0265322_10044272 3300028654 Bacteria 1268
97 Ga0265336_10000047 3300028666 Bacteria 123576
98 Ga0265338_10000003 3300028800 Bacteria 733923
99 Ga0265338_10000039 3300028800 Bacteria 236135
100 Ga0265338_10000052 3300028800 Bacteria 209239
101 Ga0265338_10000178 3300028800 Bacteria 118345
102 Ga0265338_10019537 3300028800 Bacteria 7181
103 Ga0265338_10022002 3300028800 Bacteria 6625
104 Ga0265338_10030969 3300028800 Bacteria 5255
105 Ga0265338_10033225 3300028800 Bacteria 5011
106 Ga0265338_10168155 3300028800 Bacteria 1685
107 Ga0265338_10208283 3300028800 Unclassified 1469
108 Ga0265338_10382617 3300028800 Unclassified 1006
109 Ga0265338_10436168 3300028800 Bacteria 929
110 Ga0265320_10050693 3300031240 Bacteria 2016
111 Ga0265325_10129684 3300031241 Bacteria 1209
112 Ga0265329_10079467 3300031242 Bacteria 1038
113 Ga0265339_10380907 3300031249 Bacteria 661
114 Ga0265327_10000017 3300031251 Bacteria 445264
115 Ga0265327_10000961 3300031251 Bacteria 41308
116 Ga0265327_10261410 3300031251 Unclassified 769
117 Ga0265316_10185325 3300031344 Bacteria 1548
118 Ga0265316_10285187 3300031344 Bacteria 1206
119 Ga0265316_10921146 3300031344 Bacteria 610
120 Ga0307513_10415275 3300031456 Unclassified 1077
121 Ga0265313_10012285 3300031595 Bacteria 5241
122 Ga0265314_10135881 3300031711 Bacteria 1527
123 Ga0307516_10000078 3300031730 Bacteria 106523
124 Ga0373959_0000004 3300034820 Bacteria 100872
125 Ga0395905_0002005 3300037471 Bacteria 23268
126 Ga0395901_0321106 3300038443 Bacteria 1602
127 Ga0451802_1462861 3300041460 Unclassified 817
128 Ga0495672_0000129 3300047320 Bacteria 112879
129 Ga0495672_0249596 3300047320 Unclassified 862
130 Ga0496118_0088708 3300048921 Bacteria 2138
131 Ga0501037_0274484 3300049573 Unclassified 1176
132 Ga0501046_0095123 3300049580 Bacteria 2289
133 Ga0501070_0043619 3300049586 Bacteria 3732
134 Ga0501072_1481793 3300049588 Unclassified 524
135 Ga0501080_0169063 3300049742 Unclassified 2017
136 nmdc:mga03683_706_c2 3300050489 Bacteria 4888
137 nmdc:mga0yw44_546724_c1 3300050492 Bacteria 786
138 nmdc:mga0k408_17_c2 3300050493 Bacteria 97852
139 Ga0500644_0076746 3300053088 Bacteria 1218
140 Ga0500593_000001 3300053117 Bacteria 784404
141 Ga0500594_0002386 3300053118 Bacteria 4087
142 Ga0500628_000012 3300053129 Bacteria 106556
143 Ga0500604_0107452 3300053151 Bacteria 924
144 Ga0495672_0046160
145 rootH2_10000244
146 Ga0070658_10003525
147 Ga0070683_100415983
148 Ga0070680_100245053
149 Ga0068868_102004473
150 Ga0070671_100768588
151 Ga0070713_100599635
152 Ga0070681_11037924
153 Ga0068867_100081453
154 Ga0070679_100301821
155 Ga0070679_100445914
156 Ga0070684_100874954
157 Ga0068853_100878741
158 Ga0070686_101595167
159 Ga0068855_100037222
160 Ga0068855_100083601
161 Ga0068855_100179086
162 Ga0068855_100216914
163 Ga0068855_101549114
164 Ga0068855_101862809
165 Ga0070664_100249474
166 Ga0068856_101478317
167 Ga0068856_101798636
168 Ga0068856_102420418
169 Ga0068862_100014078
170 Ga0070717_10406067
171 Ga0070717_10930794
172 Ga0075365_10999940
173 Ga0075364_10058459
174 Ga0075362_10020843
175 Ga0075366_10000342
176 Ga0097621_100000003
177 Ga0097621_100001002
178 Ga0097621_101240263
179 Ga0068871_100000013
180 Ga0068871_101926997
181 Ga0075428_100074834
182 Ga0105240_11032551
183 Ga0105245_10452501
184 Ga0105245_10512987
185 Ga0105245_11464210
186 Ga0105247_10165159
187 Ga0105241_10000367
188 Ga0105241_10556227
189 Ga0105241_11148847
190 Ga0105242_10133850
191 Ga0105242_10256925
192 Ga0105238_10631913
193 Ga0105238_10667620
194 Ga0105246_10310891
195 Ga0157373_10460323
196 Ga0157370_10138188
197 Ga0157369_10089735
198 Ga0157369_11543443
199 Ga0157369_12408774
200 Ga0157374_12055915
201 Ga0157374_12439557
202 Ga0157372_10000194
203 Ga0157372_13423516
204 Ga0163163_10059901
205 Ga0157377_10033136
206 Ga0207705_10101386
207 Ga0207654_10000546
208 Ga0207654_10269768
209 Ga0207654_10747956
210 Ga0207654_10818867
211 Ga0207660_10042451
212 Ga0207660_11331452
213 Ga0207652_10101107
214 Ga0207652_10397982
215 Ga0207694_10737939
216 Ga0207694_10975836
217 Ga0207687_10450489
218 Ga0207687_11318967
219 Ga0207700_10492674
220 Ga0207686_10095308
221 Ga0207686_11468413
222 Ga0207661_10366306
223 Ga0207679_10715339
224 Ga0207667_10031525
225 Ga0207667_10113402
226 Ga0207667_10452129
227 Ga0207667_11242009
228 Ga0207658_10006571
229 Ga0207702_10650407
230 Ga0207648_10119715
231 Ga0207674_10353422
232 Ga0207683_11021203
233 Ga0268265_10042094
234 Ga0265337_1006253
235 Ga0265326_10003292
236 Ga0265326_10017680
237 Ga0265334_10000049
238 Ga0265334_10004026
239 Ga0265322_10044272
240 Ga0265336_10000047
241 Ga0265338_10000003
242 Ga0265338_10000039
243 Ga0265338_10000052
244 Ga0265338_10000178
245 Ga0265338_10019537
246 Ga0265338_10022002
247 Ga0265338_10030969
248 Ga0265338_10033225
249 Ga0265338_10168155
250 Ga0265338_10208283
251 Ga0265338_10382617
252 Ga0265338_10436168
253 Ga0265320_10050693
254 Ga0265325_10129684
255 Ga0265329_10079467
256 Ga0265339_10380907
257 Ga0265327_10000017
258 Ga0265327_10000961
259 Ga0265327_10261410
260 Ga0265316_10185325
261 Ga0265316_10285187
262 Ga0265316_10921146
263 Ga0307513_10415275
264 Ga0265313_10012285
265 Ga0265314_10135881
266 Ga0307516_10000078
267 Ga0373959_0000004
268 Ga0395905_0002005
269 Ga0395901_0321106
270 Ga0451802_1462861
271 Ga0495672_0000129
272 Ga0495672_0249596
273 Ga0496118_0088708
274 Ga0501037_0274484
275 Ga0501046_0095123
276 Ga0501070_0043619
277 Ga0501072_1481793
278 Ga0501080_0169063
279 nmdc:mga03683_706_c2
280 nmdc:mga0yw44_546724_c1
281 nmdc:mga0k408_17_c2
282 Ga0500644_0076746
283 Ga0500593_000001
284 Ga0500594_0002386
285 Ga0500628_000012
286 Ga0500604_0107452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

7

65

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zij-assembly2.cif.gz_B crystal structure of the thioredoxin-like protein bc3987 0.9013 4 80
7c10-assembly1.cif.gz_A dithiol cgrx1 0.8839 4 81
3zij-assembly2.cif.gz_B crystal structure of the thioredoxin-like protein bc3987 0.8789 4 80
7c10-assembly2.cif.gz_B dithiol cgrx1 0.8733 4 81
4fiw-assembly1.cif.gz_A x-ray crystal structure of corynebacterium glutamicum nrdh-redoxin at 1.5a 0.8694 5 79
ID Description Score Start End Superfamily
af_O62456_16_101_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9286 4 57 3.40.30.10
af_Q54XE7_2_89_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9115 4 57 3.40.30.10
3zijB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9013 4 80 3.40.30.10
af_A4HYU2_3_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8922 4 59 3.40.30.10
3zijB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8789 4 80 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2M7TUG3-F1-model_v4 Glutaredoxin domain-containing protein 0.9925 1 81 GO:0009055
GO:0045454
AF-A0A1F7RF92-F1-model_v4 Glutaredoxin domain-containing protein 0.9902 1 81
AF-A0A7W1KGP9-F1-model_v4 Glutaredoxin family protein 0.9882 1 81
AF-A0A7S2UXQ4-F1-model_v4 Glutaredoxin domain-containing protein 0.9751 4 57
AF-A0A2R5GWU8-F1-model_v4 Glutaredoxin 0.9707 4 57

Map