F190176

General Info

Members Datasets Scaffolds Average Seq Length
143 95 143 140

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0235962|Ga0530510_0235962_716_1234
Length 172
Sequence MKSHREELTFNIPARMDFVNITPQVQAAVKRSGVKDGLCLVNAMHITASVFINDDEPGLHEDYKRWLEELAPFDPSPARYHHNRTGEDNADAHHKRQIMGREVVVAITEGKLDFGPWEQIFYGEFDGRRPKRVLIKIIGAKPASAVYRAGTEMRPPVRDRDGQSDRPGWIPG

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
32 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
33 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
53 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
54 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
59 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
60 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
61 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
66 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
67 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
68 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
82 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
83 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
84 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
85 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
86 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
91 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
92 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
93 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
95 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.7
Rhizosphere 97.9
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10181034 3300005289 Bacteria 1221
2 Ga0065715_10889272 3300005293 Bacteria 565
3 Ga0065707_10086157 3300005295 Bacteria 5628
4 Ga0070666_10043501 3300005335 Bacteria 3008
5 Ga0070688_101130637 3300005365 Bacteria 627
6 Ga0070703_10271742 3300005406 Bacteria 696
7 Ga0070713_100708774 3300005436 Bacteria 961
8 Ga0070708_100173092 3300005445 Bacteria 2016
9 Ga0070706_100209445 3300005467 Bacteria 1820
10 Ga0070707_100329934 3300005468 Bacteria 1482
11 Ga0070707_102090862 3300005468 Bacteria 534
12 Ga0070698_100456184 3300005471 Bacteria 1214
13 Ga0070698_100648531 3300005471 Bacteria 997
14 Ga0070698_101129150 3300005471 Bacteria 732
15 Ga0070697_100195045 3300005536 Bacteria 1720
16 Ga0070686_100192915 3300005544 Bacteria 1455
17 Ga0070704_100095451 3300005549 Bacteria 2227
18 Ga0068855_100127823 3300005563 Bacteria 2904
19 Ga0068855_100324945 3300005563 Bacteria 1699
20 Ga0068856_100098588 3300005614 Bacteria 2913
21 Ga0068852_101199359 3300005616 Bacteria 780
22 Ga0068860_100078648 3300005843 Bacteria 3136
23 Ga0068860_100444609 3300005843 Bacteria 1288
24 Ga0075428_100013811 3300006844 Bacteria 8993
25 Ga0075428_100041955 3300006844 Bacteria 5031
26 Ga0075431_100176568 3300006847 Bacteria 2194
27 Ga0075429_100463045 3300006880 Bacteria 1111
28 Ga0105240_10021626 3300009093 Bacteria 8555
29 Ga0111539_10434375 3300009094 Bacteria 1529
30 Ga0111539_11421317 3300009094 Bacteria 805
31 Ga0105245_12601436 3300009098 Bacteria 559
32 Ga0114129_11068908 3300009147 Bacteria 1012
33 Ga0114129_12236230 3300009147 Bacteria 657
34 Ga0157373_11002611 3300013100 Bacteria 623
35 Ga0157373_11537588 3300013100 Bacteria 509
36 Ga0157370_10106593 3300013104 Bacteria 2622
37 Ga0157369_10065545 3300013105 Bacteria 3909
38 Ga0157375_11922284 3300013308 Bacteria 703
39 Ga0157380_11201167 3300014326 Bacteria 802
40 Ga0213873_10048064 3300021358 Bacteria 1121
41 Ga0213872_10062199 3300021361 Bacteria 1687
42 Ga0207653_10153844 3300025885 Bacteria 848
43 Ga0207692_10215013 3300025898 Bacteria 1137
44 Ga0207642_10902524 3300025899 Bacteria 566
45 Ga0207680_10026299 3300025903 Bacteria 3224
46 Ga0207684_10036821 3300025910 Bacteria 4152
47 Ga0207707_11227420 3300025912 Bacteria 606
48 Ga0207695_10000126 3300025913 Bacteria 228511
49 Ga0207663_10093718 3300025916 Bacteria 1999
50 Ga0207646_10021100 3300025922 Bacteria 6024
51 Ga0207664_11089623 3300025929 Bacteria 714
52 Ga0207704_10611398 3300025938 Bacteria 893
53 Ga0207689_10042730 3300025942 Bacteria 3748
54 Ga0207667_10176863 3300025949 Bacteria 2192
55 Ga0207667_10176873 3300025949 Bacteria 2192
56 Ga0207698_10355168 3300026142 Bacteria 1386
57 Ga0268264_11255728 3300028381 Bacteria 751
58 Ga0265338_10012373 3300028800 Bacteria 9729
59 Ga0265316_10265673 3300031344 Bacteria 1257
60 Ga0307513_10432917 3300031456 Bacteria 1043
61 Ga0307408_101973432 3300031548 Bacteria 561
62 Ga0265313_10066124 3300031595 Bacteria 1677
63 Ga0316575_10110537 3300031665 Bacteria 1121
64 Ga0316579_10018855 3300031691 Bacteria 3041
65 Ga0265314_10272639 3300031711 Bacteria 961
66 Ga0316576_10004207 3300031727 Bacteria 8597
67 Ga0316576_10028734 3300031727 Bacteria 3923
68 Ga0316576_10091795 3300031727 Bacteria 2263
69 Ga0316576_10104930 3300031727 Bacteria 2115
70 Ga0316576_10111244 3300031727 Bacteria 2053
71 Ga0316578_10106698 3300031728 Bacteria 1681
72 Ga0316578_10117940 3300031728 Bacteria 1595
73 Ga0316578_10226466 3300031728 Bacteria 1123
74 Ga0316578_10288617 3300031728 Bacteria 982
75 Ga0316578_10738454 3300031728 Bacteria 572
76 Ga0316577_10003638 3300031733 Bacteria 7827
77 Ga0316577_10200254 3300031733 Bacteria 1128
78 Ga0316583_10005787 3300032133 Bacteria 4444
79 Ga0316585_10087864 3300032137 Bacteria 1015
80 Ga0316580_10206025 3300032139 Bacteria 606
81 Ga0373955_0318048 3300035172 Bacteria 940
82 Ga0316574_0019322 3300035398 Bacteria 4017
83 Ga0316574_0188815 3300035398 Bacteria 1325
84 Ga0316574_0322575 3300035398 Bacteria 980
85 Ga0373937_0447486 3300036401 Bacteria 1227
86 Ga0316582_0072598 3300036647 Bacteria 2231
87 Ga0316582_0092700 3300036647 Bacteria 1991
88 Ga0316582_0272989 3300036647 Bacteria 1160
89 Ga0316584_0006037 3300036712 Bacteria 8186
90 Ga0316584_0029519 3300036712 Bacteria 4048
91 Ga0316584_0148352 3300036712 Bacteria 1747
92 Ga0316584_0983739 3300036712 Bacteria 564
93 Ga0400489_26566 3300039093 Bacteria 2660
94 Ga0436360_0070058 3300039438 Bacteria 4325
95 Ga0436360_0541796 3300039438 Bacteria 628
96 Ga0436360_0543972 3300039438 Bacteria 504
97 Ga0436360_0695911 3300039438 Bacteria 773
98 Ga0436361_0393504 3300039447 Bacteria 3984
99 Ga0436361_0560631 3300039447 Bacteria 587
100 Ga0436362_0331694 3300039453 Bacteria 663
101 Ga0451577_0000009 3300042876 Bacteria 646744
102 Ga0453683_0001525 3300044673 Bacteria 19761
103 Ga0453684_0000323 3300044712 Bacteria 202159
104 Ga0453684_0000513 3300044712 Bacteria 149882
105 Ga0453684_0000902 3300044712 Bacteria 99035
106 Ga0453684_0004845 3300044712 Bacteria 27625
107 Ga0453684_0013796 3300044712 Bacteria 13063
108 Ga0453684_0146707 3300044712 Bacteria 2809
109 Ga0451576_0001232 3300045051 Bacteria 45332
110 Ga0451576_0532044 3300045051 Bacteria 1235
111 Ga0495635_0934959 3300046663 Bacteria 554
112 Ga0496109_1720972 3300048912 Bacteria 561
113 Ga0501034_0987731 3300049571 Bacteria 726
114 Ga0501038_0854256 3300049574 Unclassified 674
115 Ga0501038_0864916 3300049574 Bacteria 669
116 Ga0501039_0368710 3300049575 Bacteria 1128
117 Ga0501040_1111275 3300049576 Bacteria 573
118 Ga0501071_0268678 3300049587 Archaea 1289
119 Ga0501072_0662325 3300049588 Bacteria 821
120 Ga0501072_1146029 3300049588 Bacteria 605
121 Ga0501075_0014120 3300049591 Archaea 5722
122 Ga0501075_0298325 3300049591 Bacteria 1228
123 Ga0501076_0054124 3300049592 Bacteria 3180
124 Ga0501076_0664091 3300049592 Bacteria 860
125 Ga0501079_0027192 3300049741 Unclassified 4385
126 Ga0501079_1621920 3300049741 Bacteria 509
127 Ga0501081_0001760 3300049743 Archaea 13426
128 Ga0501081_0345844 3300049743 Bacteria 1095
129 Ga0501044_0870334 3300049823 Bacteria 777
130 Ga0501045_0909307 3300049824 Bacteria 646
131 nmdc:mga05p37_1142782_c1 3300050507 Bacteria 811
132 nmdc:mga05p37_566856_c1 3300050507 Bacteria 1289
133 nmdc:mga06r32_2034388_c1 3300050510 Bacteria 508
134 Ga0495595_0735705 3300053084 Bacteria 506
135 Ga0501084_0009183 3300054114 Archaea 8176
136 Ga0501084_1320501 3300054114 Bacteria 604
137 Ga0590071_107506 3300059421 Bacteria 706
138 Ga0501082_0107910 3300060353 Archaea 2409
139 Ga0501082_0404653 3300060353 Bacteria 1191
140 Ga0501082_0778852 3300060353 Bacteria 837
141 Ga0530510_0037659 3300061734 Unclassified 3490
142 Ga0530510_0235962 3300061734 Bacteria 1361
143 Ga0530510_1387354 3300061734 Bacteria 539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0146707 Ga0453684_0146707_727_1125 132
2 3300005471 Ga0070698_100648531 Ga0070698_1006485311 137
3 3300009147 Ga0114129_12236230 Ga0114129_122362301 137
4 3300031344 Ga0265316_10265673 Ga0265316_102656732 138
5 3300031728 Ga0316578_10106698 Ga0316578_101066982 138
6 3300035172 Ga0373955_0318048 Ga0373955_0318048_422_838 138
7 3300036401 Ga0373937_0447486 Ga0373937_0447486_597_1013 138
8 3300042876 Ga0451577_0000009 Ga0451577_0000009_376844_377260 138
9 3300044673 Ga0453683_0001525 Ga0453683_0001525_689_1105 138
10 3300044712 Ga0453684_0000323 Ga0453684_0000323_34578_34994 138
11 3300044712 Ga0453684_0000902 Ga0453684_0000902_82481_82900 138
12 3300044712 Ga0453684_0004845 Ga0453684_0004845_1342_1761 138
13 3300044712 Ga0453684_0013796 Ga0453684_0013796_5029_5448 138
14 3300045051 Ga0451576_0001232 Ga0451576_0001232_38196_38612 138
15 3300046663 Ga0495635_0934959 Ga0495635_0934959_111_527 138
16 3300049574 Ga0501038_0854256 Ga0501038_0854256_176_592 138
17 3300049574 Ga0501038_0864916 Ga0501038_0864916_78_494 138
18 3300049576 Ga0501040_1111275 Ga0501040_1111275_78_494 138
19 3300049587 Ga0501071_0268678 Ga0501071_0268678_588_1004 138
20 3300049588 Ga0501072_0662325 Ga0501072_0662325_61_477 138
21 3300049591 Ga0501075_0014120 Ga0501075_0014120_1906_2322 138
22 3300049591 Ga0501075_0298325 Ga0501075_0298325_249_665 138
23 3300049592 Ga0501076_0054124 Ga0501076_0054124_2595_3011 138
24 3300049592 Ga0501076_0664091 Ga0501076_0664091_200_616 138
25 3300049741 Ga0501079_0027192 Ga0501079_0027192_475_891 138
26 3300049741 Ga0501079_1621920 Ga0501079_1621920_61_477 138
27 3300049743 Ga0501081_0001760 Ga0501081_0001760_9534_9950 138
28 3300049743 Ga0501081_0345844 Ga0501081_0345844_110_526 138
29 3300049824 Ga0501045_0909307 Ga0501045_0909307_103_519 138
30 3300054114 Ga0501084_0009183 Ga0501084_0009183_1427_1843 138
31 3300054114 Ga0501084_1320501 Ga0501084_1320501_152_568 138
32 3300060353 Ga0501082_0107910 Ga0501082_0107910_435_851 138
33 3300060353 Ga0501082_0404653 Ga0501082_0404653_343_759 138
34 3300061734 Ga0530510_0037659 Ga0530510_0037659_2771_3187 138
35 3300061734 Ga0530510_1387354 Ga0530510_1387354_87_503 138
36 3300005365 Ga0070688_101130637 Ga0070688_1011306371 139
37 3300009094 Ga0111539_10434375 Ga0111539_104343752 139
38 3300025899 Ga0207642_10902524 Ga0207642_109025241 139
39 3300028800 Ga0265338_10012373 Ga0265338_100123733 139
40 3300031728 Ga0316578_10288617 Ga0316578_102886172 139
41 3300035398 Ga0316574_0322575 Ga0316574_0322575_518_937 139
42 3300039447 Ga0436361_0393504 Ga0436361_0393504_327_746 139
43 3300039453 Ga0436362_0331694 Ga0436362_0331694_172_591 139
44 3300044712 Ga0453684_0000513 Ga0453684_0000513_102669_103088 139
45 3300045051 Ga0451576_0532044 Ga0451576_0532044_775_1194 139
46 3300048912 Ga0496109_1720972 Ga0496109_1720972_111_530 139
47 3300005289 Ga0065704_10181034 Ga0065704_101810342 140
48 3300005293 Ga0065715_10889272 Ga0065715_108892721 140
49 3300005295 Ga0065707_10086157 Ga0065707_100861577 140
50 3300005335 Ga0070666_10043501 Ga0070666_100435011 140
51 3300005406 Ga0070703_10271742 Ga0070703_102717422 140
52 3300005436 Ga0070713_100708774 Ga0070713_1007087741 140
53 3300005445 Ga0070708_100173092 Ga0070708_1001730922 140
54 3300005467 Ga0070706_100209445 Ga0070706_1002094451 140
55 3300005468 Ga0070707_100329934 Ga0070707_1003299342 140
56 3300005468 Ga0070707_102090862 Ga0070707_1020908621 140
57 3300005471 Ga0070698_100456184 Ga0070698_1004561841 140
58 3300005471 Ga0070698_101129150 Ga0070698_1011291502 140
59 3300005536 Ga0070697_100195045 Ga0070697_1001950452 140
60 3300005544 Ga0070686_100192915 Ga0070686_1001929153 140
61 3300005549 Ga0070704_100095451 Ga0070704_1000954512 140
62 3300005563 Ga0068855_100127823 Ga0068855_1001278232 140
63 3300005563 Ga0068855_100324945 Ga0068855_1003249452 140
64 3300005614 Ga0068856_100098588 Ga0068856_1000985883 140
65 3300005616 Ga0068852_101199359 Ga0068852_1011993592 140
66 3300005843 Ga0068860_100078648 Ga0068860_1000786485 140
67 3300005843 Ga0068860_100444609 Ga0068860_1004446093 140
68 3300006844 Ga0075428_100013811 Ga0075428_1000138112 140
69 3300006844 Ga0075428_100041955 Ga0075428_1000419553 140
70 3300006847 Ga0075431_100176568 Ga0075431_1001765682 140
71 3300006880 Ga0075429_100463045 Ga0075429_1004630452 140
72 3300009093 Ga0105240_10021626 Ga0105240_100216269 140
73 3300009094 Ga0111539_11421317 Ga0111539_114213172 140
74 3300009098 Ga0105245_12601436 Ga0105245_126014361 140
75 3300009147 Ga0114129_11068908 Ga0114129_110689082 140
76 3300013100 Ga0157373_11002611 Ga0157373_110026111 140
77 3300013100 Ga0157373_11537588 Ga0157373_115375881 140
78 3300013104 Ga0157370_10106593 Ga0157370_101065932 140
79 3300013105 Ga0157369_10065545 Ga0157369_100655453 140
80 3300013308 Ga0157375_11922284 Ga0157375_119222842 140
81 3300014326 Ga0157380_11201167 Ga0157380_112011671 140
82 3300021358 Ga0213873_10048064 Ga0213873_100480642 140
83 3300021361 Ga0213872_10062199 Ga0213872_100621992 140
84 3300025885 Ga0207653_10153844 Ga0207653_101538442 140
85 3300025898 Ga0207692_10215013 Ga0207692_102150131 140
86 3300025903 Ga0207680_10026299 Ga0207680_100262994 140
87 3300025910 Ga0207684_10036821 Ga0207684_100368215 140
88 3300025912 Ga0207707_11227420 Ga0207707_112274201 140
89 3300025913 Ga0207695_10000126 Ga0207695_10000126119 140
90 3300025916 Ga0207663_10093718 Ga0207663_100937182 140
91 3300025922 Ga0207646_10021100 Ga0207646_100211005 140
92 3300025929 Ga0207664_11089623 Ga0207664_110896231 140
93 3300025938 Ga0207704_10611398 Ga0207704_106113982 140
94 3300025942 Ga0207689_10042730 Ga0207689_100427305 140
95 3300025949 Ga0207667_10176863 Ga0207667_101768632 140
96 3300025949 Ga0207667_10176873 Ga0207667_101768733 140
97 3300026142 Ga0207698_10355168 Ga0207698_103551682 140
98 3300028381 Ga0268264_11255728 Ga0268264_112557282 140
99 3300031456 Ga0307513_10432917 Ga0307513_104329172 140
100 3300031548 Ga0307408_101973432 Ga0307408_1019734321 140
101 3300031595 Ga0265313_10066124 Ga0265313_100661242 140
102 3300031665 Ga0316575_10110537 Ga0316575_101105372 140
103 3300031691 Ga0316579_10018855 Ga0316579_100188552 140
104 3300031711 Ga0265314_10272639 Ga0265314_102726391 140
105 3300031727 Ga0316576_10004207 Ga0316576_100042072 140
106 3300031727 Ga0316576_10028734 Ga0316576_100287343 140
107 3300031727 Ga0316576_10091795 Ga0316576_100917953 140
108 3300031727 Ga0316576_10104930 Ga0316576_101049303 140
109 3300031727 Ga0316576_10111244 Ga0316576_101112442 140
110 3300031728 Ga0316578_10117940 Ga0316578_101179402 140
111 3300031728 Ga0316578_10226466 Ga0316578_102264662 140
112 3300031728 Ga0316578_10738454 Ga0316578_107384541 140
113 3300031733 Ga0316577_10003638 Ga0316577_100036382 140
114 3300031733 Ga0316577_10200254 Ga0316577_102002542 140
115 3300032133 Ga0316583_10005787 Ga0316583_100057872 140
116 3300032137 Ga0316585_10087864 Ga0316585_100878642 140
117 3300032139 Ga0316580_10206025 Ga0316580_102060251 140
118 3300035398 Ga0316574_0019322 Ga0316574_0019322_308_730 140
119 3300035398 Ga0316574_0188815 Ga0316574_0188815_518_940 140
120 3300036647 Ga0316582_0072598 Ga0316582_0072598_1290_1712 140
121 3300036647 Ga0316582_0092700 Ga0316582_0092700_724_1146 140
122 3300036647 Ga0316582_0272989 Ga0316582_0272989_411_833 140
123 3300036712 Ga0316584_0006037 Ga0316584_0006037_6400_6822 140
124 3300036712 Ga0316584_0029519 Ga0316584_0029519_129_551 140
125 3300036712 Ga0316584_0148352 Ga0316584_0148352_601_1023 140
126 3300036712 Ga0316584_0983739 Ga0316584_0983739_31_453 140
127 3300039093 Ga0400489_26566 Ga0400489_26566_1713_2135 140
128 3300039438 Ga0436360_0070058 Ga0436360_0070058_1260_1682 140
129 3300039438 Ga0436360_0541796 Ga0436360_0541796_127_549 140
130 3300039438 Ga0436360_0543972 Ga0436360_0543972_40_462 140
131 3300039438 Ga0436360_0695911 Ga0436360_0695911_105_527 140
132 3300039447 Ga0436361_0560631 Ga0436361_0560631_151_573 140
133 3300049571 Ga0501034_0987731 Ga0501034_0987731_208_630 140
134 3300049575 Ga0501039_0368710 Ga0501039_0368710_354_794 140
135 3300049588 Ga0501072_1146029 Ga0501072_1146029_49_471 140
136 3300049823 Ga0501044_0870334 Ga0501044_0870334_65_487 140
137 3300050507 nmdc:mga05p37_1142782_c1 nmdc:mga05p37_1142782_c1_251_673 140
138 3300050507 nmdc:mga05p37_566856_c1 nmdc:mga05p37_566856_c1_456_878 140
139 3300050510 nmdc:mga06r32_2034388_c1 nmdc:mga06r32_2034388_c1_24_446 140
140 3300053084 Ga0495595_0735705 Ga0495595_0735705_19_441 140
141 3300059421 Ga0590071_107506 Ga0590071_107506_77_499 140
142 3300060353 Ga0501082_0778852 Ga0501082_0778852_105_545 140
143 3300061734 Ga0530510_0235962 Ga0530510_0235962_716_1234 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

20

137

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.9802 1 140
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9786 1 140
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.9733 1 140
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9716 1 140
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9598 4 138
ID Description Score Start End Superfamily
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9787 1 140 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9717 1 140 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9496 4 140 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9492 6 138 2.60.120.460
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9365 2 140 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A517Z1G6-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.996 2 140
AF-A0A142YKJ4-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9954 2 140
AF-A0A3M1Q255-F1-model_v4 YjbQ family protein 0.9934 14 140
AF-K5DCJ7-F1-model_v4 Protein belonging to uncharacterized protein family UPF0047 0.9924 2 140
AF-A0A2E7KD61-F1-model_v4 deleted 0.9894 12 140

Feature Viewer

pLDDT pTM Quality
96.65 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map