F192564

General Info

Members Datasets Scaffolds Average Seq Length
144 112 288 219

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0004759|Ga0466957_0004759_2613_3350
Length 245
Sequence LLLDSLAVEGHSLHFLFPQNLLFMRLLLYISSFIAITLVSFTGMQQKQKIVFFGDSITQAGVSPNGYITVLGNMIAQKGLKDQYELVGAGISGNKVTDLYLRLEDDVLAKNPTTVVIWIGVNDVWHKKMGTGTDAAKFEQFYNAILKKLQAKNIKVVMCTPATIGEKTDFSNELDGDLNKYANMVRSIAAQNNCALIDLRKAFLAYNLANNTANNDKGILTADGVHLNDKGNMLVAGEMMKALVK

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
56 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
57 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
60 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
61 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
62 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
63 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
64 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
65 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
66 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
70 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
71 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
74 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
75 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
76 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
77 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
80 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
81 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
94 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
95 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
99 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
100 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
101 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
102 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
103 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
104 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
105 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
106 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
107 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
108 2738541278 Niastella sp. CF465 Isolate Unclassified
109 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
110 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
111 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
112 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.53
Metatranscriptomes 0
Isolates 3.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.03
Nodule 0
Rhizoplane 2.08
Rhizosphere 79.17
Stem 0
Stem Tuber 0
Unclassified 13.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0004759 3300044842 Bacteria 7597
2 rootH1_10058641 3300003316 Bacteria 6042
3 rootL2_10038377 3300003322 Bacteria 1775
4 rootL2_10094515 3300003322 Bacteria 2884
5 rootL2_10094516 3300003322 Bacteria 2221
6 rootH1_10027473 3300003323 Bacteria 20275
7 rootH1_10045724 3300003323 Bacteria 1883
8 Ga0055531_10000128 3300003794 Bacteria 85521
9 Ga0065704_10403312 3300005289 Unclassified 749
10 Ga0065707_10121166 3300005295 Bacteria 2104
11 Ga0070676_10094372 3300005328 Bacteria 1838
12 Ga0070682_100007190 3300005337 Bacteria 6272
13 Ga0070660_100161950 3300005339 Unclassified 1803
14 Ga0070691_10002535 3300005341 Bacteria 8137
15 Ga0070668_100662659 3300005347 Unclassified 918
16 Ga0070681_10263240 3300005458 Unclassified 1636
17 Ga0068867_100332443 3300005459 Bacteria 1262
18 Ga0070698_100001058 3300005471 Bacteria 30280
19 Ga0070698_100002424 3300005471 Bacteria 20548
20 Ga0070698_100194717 3300005471 Bacteria 1964
21 Ga0070679_100045509 3300005530 Unclassified 4373
22 Ga0068853_100028884 3300005539 Bacteria 4669
23 Ga0068853_100275191 3300005539 Bacteria 1551
24 Ga0070693_100034870 3300005547 Unclassified 2786
25 Ga0070704_100935063 3300005549 Bacteria 781
26 Ga0068855_100285584 3300005563 Unclassified 1831
27 Ga0068855_100678959 3300005563 Bacteria 1104
28 Ga0068859_100094474 3300005617 Bacteria 3042
29 Ga0068851_10383977 3300005834 Unclassified 823
30 Ga0068860_100016470 3300005843 Bacteria 7209
31 Ga0097621_100002550 3300006237 Bacteria 12478
32 Ga0075428_100007201 3300006844 Bacteria 12321
33 Ga0075428_100010621 3300006844 Bacteria 10233
34 Ga0075428_100183613 3300006844 Bacteria 2263
35 Ga0105240_10001324 3300009093 Bacteria 42710
36 Ga0105240_10100022 3300009093 Bacteria 3529
37 Ga0105240_10353815 3300009093 Bacteria 1666
38 Ga0105241_10000319 3300009174 Bacteria 36268
39 Ga0105241_10408019 3300009174 Unclassified 1193
40 Ga0105237_10008613 3300009545 Bacteria 11029
41 Ga0105237_10122116 3300009545 Bacteria 2599
42 Ga0105239_11041702 3300010375 Bacteria 941
43 Ga0157371_10004684 3300013102 Bacteria 11824
44 Ga0157370_10000479 3300013104 Bacteria 49878
45 Ga0157370_10273399 3300013104 Bacteria 1561
46 Ga0157370_10306074 3300013104 Bacteria 1467
47 Ga0157369_10223312 3300013105 Bacteria 1971
48 Ga0157369_10782015 3300013105 Bacteria 981
49 Ga0157374_10839988 3300013296 Unclassified 935
50 Ga0157378_10094133 3300013297 Bacteria 2728
51 Ga0157378_10916385 3300013297 Unclassified 908
52 Ga0163162_10012796 3300013306 Bacteria 8198
53 Ga0163162_10652865 3300013306 Bacteria 1176
54 Ga0157372_10033830 3300013307 Bacteria 5616
55 Ga0157372_10478121 3300013307 Unclassified 1452
56 Ga0157380_10011794 3300014326 Bacteria 6322
57 Ga0157380_10965285 3300014326 Bacteria 883
58 Ga0157377_10537645 3300014745 Unclassified 823
59 Ga0157379_10176707 3300014968 Bacteria 1928
60 Ga0157376_10055580 3300014969 Bacteria 3304
61 Ga0209258_107054 3300025242 Bacteria 1698
62 Ga0207645_10161601 3300025907 Bacteria 1466
63 Ga0207654_10001369 3300025911 Bacteria 12925
64 Ga0207707_10000721 3300025912 Bacteria 32676
65 Ga0207695_10027903 3300025913 Bacteria 6275
66 Ga0207660_10001254 3300025917 Bacteria 17002
67 Ga0207652_10002045 3300025921 Bacteria 17358
68 Ga0207667_10244396 3300025949 Unclassified 1836
69 Ga0207667_10465075 3300025949 Bacteria 1284
70 Ga0207639_10096206 3300026041 Bacteria 2382
71 Ga0207639_10118965 3300026041 Bacteria 2167
72 Ga0207428_10213777 3300027907 Bacteria 1448
73 Ga0307515_10000086 3300028794 Bacteria 219523
74 Ga0307515_10056911 3300028794 Bacteria 5671
75 Ga0307515_10157147 3300028794 Bacteria 2340
76 Ga0307515_10247228 3300028794 Unclassified 1543
77 Ga0265327_10007302 3300031251 Bacteria 8570
78 Ga0307513_10284168 3300031456 Bacteria 1430
79 Ga0307513_10335380 3300031456 Unclassified 1265
80 Ga0307414_10170207 3300032004 Bacteria 1741
81 Ga0373944_0082908 3300035089 Bacteria 1062
82 Ga0373955_0062004 3300035172 Bacteria 2067
83 Ga0373927_0067464 3300035695 Bacteria 2315
84 Ga0373937_0460244 3300036401 Bacteria 1208
85 Ga0439436_0065183 3300041404 Unclassified 1017
86 Ga0439439_0005260 3300041406 Bacteria 2950
87 Ga0451800_1549198 3300041459 Bacteria 842
88 Ga0451802_1962519 3300041460 Bacteria 973
89 Ga0439431_0005778 3300041997 Bacteria 2732
90 Ga0439445_0017045 3300042004 Bacteria 1792
91 Ga0439449_0008152 3300042007 Bacteria 3982
92 Ga0439457_024281 3300042014 Bacteria 1341
93 Ga0466972_0000039 3300044658 Bacteria 135618
94 Ga0466972_0027590 3300044658 Bacteria 2808
95 Ga0495629_0122949 3300046459 Bacteria 1808
96 Ga0495580_0326551 3300046472 Bacteria 1042
97 Ga0495606_0010625 3300046507 Bacteria 7618
98 Ga0495606_0022282 3300046507 Bacteria 4618
99 Ga0495628_0364022 3300046516 Bacteria 1061
100 Ga0495630_0200257 3300046517 Bacteria 1524
101 Ga0495648_0006328 3300046524 Bacteria 9684
102 Ga0495652_0278227 3300046529 Bacteria 1227
103 Ga0495586_0033012 3300046535 Bacteria 2777
104 Ga0495609_0096158 3300046538 Bacteria 1285
105 Ga0495668_0000021 3300046616 Bacteria 381308
106 Ga0495625_0000222 3300046660 Bacteria 89536
107 Ga0495658_0010109 3300046683 Bacteria 4715
108 Ga0495670_0443766 3300046691 Bacteria 703
109 Ga0495600_0202396 3300046809 Bacteria 1275
110 Ga0495674_0145000 3300047319 Bacteria 1994
111 Ga0495602_0674766 3300048088 Unclassified 704
112 Ga0496104_0447185 3300048907 Bacteria 1204
113 Ga0501300_001703 3300049523 Bacteria 3295
114 Ga0501034_0088893 3300049571 Bacteria 3087
115 Ga0501034_0816771 3300049571 Bacteria 824
116 Ga0501047_0007662 3300049581 Bacteria 10170
117 Ga0501048_0209070 3300049582 Bacteria 1384
118 Ga0501048_0256666 3300049582 Bacteria 1242
119 Ga0501067_0031439 3300049583 Bacteria 2945
120 Ga0501070_0164308 3300049586 Bacteria 1829
121 Ga0501071_0591938 3300049587 Unclassified 853
122 Ga0501074_0317850 3300049590 Bacteria 1106
123 Ga0501238_010990 3300049671 Bacteria 1214
124 Ga0501259_089957 3300049688 Bacteria 688
125 Ga0501225_0000400 3300049705 Bacteria 13739
126 Ga0501080_0147191 3300049742 Bacteria 2177
127 Ga0501044_0021617 3300049823 Bacteria 6860
128 Ga0500578_0000034 3300053086 Bacteria 136582
129 Ga0500578_0035843 3300053086 Bacteria 3188
130 Ga0500646_0001132 3300053090 Bacteria 7206
131 Ga0500583_0000075 3300053092 Bacteria 59561
132 Ga0500583_0007779 3300053092 Bacteria 3797
133 Ga0500651_0103476 3300053093 Bacteria 1744
134 Ga0500608_060606 3300053122 Bacteria 1809
135 Ga0500652_110351 3300053131 Bacteria 1149
136 Ga0500616_0025956 3300053153 Bacteria 3248
137 Ga0500622_0087062 3300053156 Bacteria 1556
138 Ga0500639_097535 3300053163 Bacteria 1453
139 Ga0501084_0002569 3300054114 Bacteria 14628
140 2738727091 2738541278 Bacteria 9755573
141 2852623289 2852623160 Bacteria 4376875
142 2884937834 2884933994 Bacteria 4535041
143 2896089907 2896085136 Bacteria 6129793
144 2911142368 2911138879 Bacteria 5811561
145 Ga0466957_0004759
146 rootH1_10058641
147 rootL2_10038377
148 rootL2_10094515
149 rootL2_10094516
150 rootH1_10027473
151 rootH1_10045724
152 Ga0055531_10000128
153 Ga0065704_10403312
154 Ga0065707_10121166
155 Ga0070676_10094372
156 Ga0070682_100007190
157 Ga0070660_100161950
158 Ga0070691_10002535
159 Ga0070668_100662659
160 Ga0070681_10263240
161 Ga0068867_100332443
162 Ga0070698_100001058
163 Ga0070698_100002424
164 Ga0070698_100194717
165 Ga0070679_100045509
166 Ga0068853_100028884
167 Ga0068853_100275191
168 Ga0070693_100034870
169 Ga0070704_100935063
170 Ga0068855_100285584
171 Ga0068855_100678959
172 Ga0068859_100094474
173 Ga0068851_10383977
174 Ga0068860_100016470
175 Ga0097621_100002550
176 Ga0075428_100007201
177 Ga0075428_100010621
178 Ga0075428_100183613
179 Ga0105240_10001324
180 Ga0105240_10100022
181 Ga0105240_10353815
182 Ga0105241_10000319
183 Ga0105241_10408019
184 Ga0105237_10008613
185 Ga0105237_10122116
186 Ga0105239_11041702
187 Ga0157371_10004684
188 Ga0157370_10000479
189 Ga0157370_10273399
190 Ga0157370_10306074
191 Ga0157369_10223312
192 Ga0157369_10782015
193 Ga0157374_10839988
194 Ga0157378_10094133
195 Ga0157378_10916385
196 Ga0163162_10012796
197 Ga0163162_10652865
198 Ga0157372_10033830
199 Ga0157372_10478121
200 Ga0157380_10011794
201 Ga0157380_10965285
202 Ga0157377_10537645
203 Ga0157379_10176707
204 Ga0157376_10055580
205 Ga0209258_107054
206 Ga0207645_10161601
207 Ga0207654_10001369
208 Ga0207707_10000721
209 Ga0207695_10027903
210 Ga0207660_10001254
211 Ga0207652_10002045
212 Ga0207667_10244396
213 Ga0207667_10465075
214 Ga0207639_10096206
215 Ga0207639_10118965
216 Ga0207428_10213777
217 Ga0307515_10000086
218 Ga0307515_10056911
219 Ga0307515_10157147
220 Ga0307515_10247228
221 Ga0265327_10007302
222 Ga0307513_10284168
223 Ga0307513_10335380
224 Ga0307414_10170207
225 Ga0373944_0082908
226 Ga0373955_0062004
227 Ga0373927_0067464
228 Ga0373937_0460244
229 Ga0439436_0065183
230 Ga0439439_0005260
231 Ga0451800_1549198
232 Ga0451802_1962519
233 Ga0439431_0005778
234 Ga0439445_0017045
235 Ga0439449_0008152
236 Ga0439457_024281
237 Ga0466972_0000039
238 Ga0466972_0027590
239 Ga0495629_0122949
240 Ga0495580_0326551
241 Ga0495606_0010625
242 Ga0495606_0022282
243 Ga0495628_0364022
244 Ga0495630_0200257
245 Ga0495648_0006328
246 Ga0495652_0278227
247 Ga0495586_0033012
248 Ga0495609_0096158
249 Ga0495668_0000021
250 Ga0495625_0000222
251 Ga0495658_0010109
252 Ga0495670_0443766
253 Ga0495600_0202396
254 Ga0495674_0145000
255 Ga0495602_0674766
256 Ga0496104_0447185
257 Ga0501300_001703
258 Ga0501034_0088893
259 Ga0501034_0816771
260 Ga0501047_0007662
261 Ga0501048_0209070
262 Ga0501048_0256666
263 Ga0501067_0031439
264 Ga0501070_0164308
265 Ga0501071_0591938
266 Ga0501074_0317850
267 Ga0501238_010990
268 Ga0501259_089957
269 Ga0501225_0000400
270 Ga0501080_0147191
271 Ga0501044_0021617
272 Ga0500578_0000034
273 Ga0500578_0035843
274 Ga0500646_0001132
275 Ga0500583_0000075
276 Ga0500583_0007779
277 Ga0500651_0103476
278 Ga0500608_060606
279 Ga0500652_110351
280 Ga0500616_0025956
281 Ga0500622_0087062
282 Ga0500639_097535
283 Ga0501084_0002569
284 2738727091
285 2852623289
286 2884937834
287 2896089907
288 2911142368

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13472

Lipase_GDSL_2

GDSL-like Lipase/Acylhydrolase family

52

234

0.87

PF17182

OSK

OSK domain

73

214

0.82

PF00657

Lipase_GDSL

GDSL-like Lipase/Acylhydrolase

50

239

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ddy-assembly1.cif.gz_D crystal structure of an acetyl xylan esterase alaxease 0.9714 26 221
7ddy-assembly1.cif.gz_D crystal structure of an acetyl xylan esterase alaxease 0.957 26 221
3rjt-assembly1.cif.gz_B crystal structure of lipolytic protein g-d-s-l family from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446 0.8796 25 221
4jj4-assembly1.cif.gz_A crystal structure of a catalytic mutant of axe2 (axe2-d191a), an acetylxylan esterase from geobacillus stearothermophilus 0.8669 25 218
5jd3-assembly1.cif.gz_A crystal structure of lae5, an alpha/beta hydrolase enzyme from the metagenome of lake arreo, spain 0.8625 25 218
ID Description Score Start End Superfamily
af_A0A1D6KCH8_139_292_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8519 24 126 3.40.50.1110
1yzfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8399 25 218 3.40.50.1110
4q9aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8159 24 215 3.40.50.1110
af_O74648_36_245_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8126 24 220 3.40.50.1110
3rjtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8119 25 221 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A6N4EIY3-F1-model_v4 deleted 0.9882 121 220
AF-R9GUS7-F1-model_v4 Lipase/acylhydrolase family protein 0.9785 23 222 GO:0004622
AF-A0A521G9V8-F1-model_v4 G-D-S-L family lipolytic protein 0.9771 23 220 GO:0004622
AF-A0A519XW69-F1-model_v4 G-D-S-L family lipolytic protein 0.9726 136 220
AF-A0A6C0GML6-F1-model_v4 SGNH/GDSL hydrolase family protein 0.9725 18 220 GO:0004622
GO:0016020

Map