F193239

General Info

Members Datasets Scaffolds Average Seq Length
144 108 111 218

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2922554459|2922556735
Length 248
Sequence IAATSSEPELTTGRVPAVLSFFGRASVSKVTAPMGKALVKTGLTPDSVTVIGTVASVAGAVTLFPSGHLFWGTLFIWFFVMFDMLDGAMARARGGGTRYGAVLDATCDRVADGAIFAGLAWWAVYHENSKWLLVATLICLVTSQVISYAKARAEASGLTADGGWIERPDRLIIVLVGSGLTGMGLPWAIHIAMWVLAAGSVVTVFQRVLAVRNSPGARELLPIAPAASTVEGAAGTEGDPKPEGEAEQ

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2558860280 Kutzneria sp. 744 Isolate Unclassified
5 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
6 2643221692 Nocardia sp. Root136 Isolate Unclassified
7 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
8 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
9 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
10 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
11 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
12 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
13 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
14 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
15 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
16 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
17 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
18 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
19 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
20 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
21 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
22 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
23 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
24 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
25 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
26 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
27 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
28 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
29 2922554459 Rhodococcus sp. 66b Isolate Unclassified
30 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
31 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
32 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
33 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
84 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
85 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
86 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
97 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
98 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
101 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
102 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
103 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
104 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
105 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
106 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
107 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
108 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.08
Metatranscriptomes 0
Isolates 22.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0
Endosphere 18.06
Nodule 0
Rhizoplane 0
Rhizosphere 63.19
Stem 0
Stem Tuber 0
Unclassified 18.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1000065 3300003792 Bacteria 126812
2 Ga0055540_1000951 3300003792 Bacteria 18813
3 Ga0070667_100005427 3300005367 Bacteria 10654
4 Ga0070714_100002007 3300005435 Bacteria 14885
5 Ga0070714_100051834 3300005435 Bacteria 3499
6 Ga0070714_100343368 3300005435 Bacteria 1401
7 Ga0070713_100038923 3300005436 Bacteria 3856
8 Ga0070713_100121905 3300005436 Bacteria 2288
9 Ga0068853_100007909 3300005539 Bacteria 8526
10 Ga0068853_100045670 3300005539 Bacteria 3753
11 Ga0068854_100946166 3300005578 Bacteria 760
12 Ga0068852_100013610 3300005616 Bacteria 6228
13 Ga0075365_10091863 3300006038 Bacteria 2069
14 Ga0075363_100128955 3300006048 Bacteria 1417
15 Ga0075363_100291188 3300006048 Bacteria 946
16 Ga0075364_10027071 3300006051 Bacteria 3660
17 Ga0075364_10269636 3300006051 Bacteria 1158
18 Ga0070716_100292486 3300006173 Bacteria 1129
19 Ga0075362_10248228 3300006177 Bacteria 875
20 Ga0075367_10283664 3300006178 Bacteria 1041
21 Ga0075369_10012892 3300006186 Bacteria 3307
22 Ga0075369_10120157 3300006186 Bacteria 1189
23 Ga0075370_10018375 3300006353 Bacteria 3794
24 Ga0105243_10014575 3300009148 Bacteria 5948
25 Ga0105243_10398379 3300009148 Bacteria 1278
26 Ga0105239_10564893 3300010375 Bacteria 1296
27 Ga0157369_10205667 3300013105 Bacteria 2065
28 Ga0213872_10121510 3300021361 Bacteria 1155
29 Ga0213876_10056103 3300021384 Bacteria 2079
30 Ga0209051_1004758 3300025303 Bacteria 8205
31 Ga0207692_10058538 3300025898 Bacteria 1985
32 Ga0207700_10032604 3300025928 Bacteria 3718
33 Ga0207664_10012873 3300025929 Bacteria 5994
34 Ga0207664_10042685 3300025929 Bacteria 3542
35 Ga0207709_10003169 3300025935 Bacteria 9881
36 Ga0207665_10309863 3300025939 Bacteria 1182
37 Ga0207658_10045469 3300025986 Bacteria 3200
38 Ga0207639_10015704 3300026041 Bacteria 5341
39 Ga0265327_10000062 3300031251 Bacteria 234320
40 Ga0265327_10000064 3300031251 Bacteria 231983
41 Ga0265327_10005264 3300031251 Bacteria 10897
42 Ga0307518_10170321 3300031838 Bacteria 1485
43 Ga0307416_100718120 3300032002 Bacteria 1090
44 Ga0373949_0104868 3300035090 Bacteria 778
45 Ga0436364_0425919 3300037853 Bacteria 2311
46 Ga0436365_1666845 3300039437 Bacteria 12280
47 Ga0436361_0383263 3300039447 Bacteria 638
48 Ga0436361_0931192 3300039447 Bacteria 891
49 Ga0466969_0031028 3300044656 Bacteria 2722
50 Ga0466969_0127302 3300044656 Bacteria 1183
51 Ga0466965_0074397 3300044683 Bacteria 1712
52 Ga0466965_0226776 3300044683 Bacteria 997
53 Ga0466966_0004853 3300044684 Bacteria 8848
54 Ga0466966_0089647 3300044684 Bacteria 1910
55 Ga0466966_0111713 3300044684 Bacteria 1684
56 Ga0466961_0011614 3300044693 Bacteria 5629
57 Ga0466961_0064699 3300044693 Bacteria 2324
58 Ga0466963_0005417 3300044694 Bacteria 7471
59 Ga0466963_0279784 3300044694 Bacteria 1173
60 Ga0466964_0067059 3300044706 Bacteria 1508
61 Ga0466971_0007213 3300044719 Bacteria 4841
62 Ga0466971_0285105 3300044719 Bacteria 791
63 Ga0466968_0080655 3300044735 Bacteria 1429
64 Ga0466970_0036303 3300044765 Bacteria 2611
65 Ga0466970_0038610 3300044765 Bacteria 2533
66 Ga0466970_0102380 3300044765 Bacteria 1560
67 Ga0466957_0000944 3300044842 Bacteria 14885
68 Ga0466957_0011746 3300044842 Bacteria 5061
69 Ga0466957_0133415 3300044842 Bacteria 1594
70 Ga0466959_0006765 3300045049 Bacteria 7986
71 Ga0466959_0020538 3300045049 Bacteria 4868
72 Ga0466959_0147504 3300045049 Bacteria 1659
73 Ga0466958_0067266 3300045836 Bacteria 2188
74 Ga0466958_0152428 3300045836 Bacteria 1458
75 Ga0466958_0351379 3300045836 Bacteria 949
76 Ga0466967_0062383 3300045976 Bacteria 3308
77 Ga0466967_0123025 3300045976 Bacteria 2400
78 Ga0466967_0209436 3300045976 Bacteria 1849
79 Ga0495580_0127064 3300046472 Bacteria 1770
80 Ga0495607_0037079 3300046501 Bacteria 2931
81 Ga0495668_0001622 3300046616 Bacteria 21041
82 Ga0495672_0032900 3300047320 Bacteria 3218
83 Ga0495683_0000599 3300047323 Bacteria 27097
84 Ga0496126_0045997 3300048929 Bacteria 4007
85 Ga0496126_0278997 3300048929 Bacteria 1385
86 Ga0496126_0385147 3300048929 Bacteria 1140
87 Ga0501033_0033920 3300049570 Bacteria 3831
88 Ga0501034_0023258 3300049571 Bacteria 6315
89 Ga0501036_0105280 3300049572 Bacteria 2386
90 Ga0501046_0301326 3300049580 Bacteria 1170
91 Ga0501047_0034848 3300049581 Bacteria 4860
92 Ga0501047_0080620 3300049581 Bacteria 3128
93 Ga0501069_0025765 3300049585 Bacteria 3216
94 Ga0501035_0001705 3300049822 Bacteria 22196
95 Ga0501044_0028712 3300049823 Bacteria 5869
96 Ga0501044_0117956 3300049823 Bacteria 2657
97 nmdc:mga03n38_48872_c1 3300050490 Bacteria 1521
98 nmdc:mga00v17_34386_c1 3300050491 Bacteria 3010
99 nmdc:mga07m45_90171_c1 3300050496 Bacteria 1756
100 nmdc:mga09592_133120_c1 3300050508 Bacteria 2140
101 nmdc:mga0sz30_188412_c1 3300050516 Bacteria 916
102 nmdc:mga0sz30_211616_c1 3300050516 Bacteria 861
103 Ga0500635_0065579 3300053080 Bacteria 1277
104 Ga0500643_007146 3300053087 Bacteria 4565
105 Ga0500641_0199319 3300053096 Bacteria 855
106 Ga0500652_018824 3300053131 Bacteria 2556
107 Ga0500658_0023880 3300053134 Bacteria 2339
108 Ga0500559_0072528 3300053136 Bacteria 1552
109 Ga0500645_000171 3300053730 Bacteria 51112
110 Ga0500645_087143 3300053730 Bacteria 887
111 Ga0466962_0000231 3300061719 Bacteria 23213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0031028 Ga0466969_0031028_476_1081 195
2 3300044684 Ga0466966_0089647 Ga0466966_0089647_1151_1756 195
3 3300044693 Ga0466961_0011614 Ga0466961_0011614_378_983 195
4 3300044765 Ga0466970_0102380 Ga0466970_0102380_382_987 195
5 3300044842 Ga0466957_0011746 Ga0466957_0011746_864_1469 195
6 3300045049 Ga0466959_0020538 Ga0466959_0020538_2496_3101 195
7 3300045836 Ga0466958_0152428 Ga0466958_0152428_288_893 195
8 3300013105 Ga0157369_10205667 Ga0157369_102056672 196
9 3300039447 Ga0436361_0383263 Ga0436361_0383263_32_625 196
10 iso_pu_bacteria 2558860280 2559424704 199
11 3300044765 Ga0466970_0038610 Ga0466970_0038610_1738_2352 202
12 iso_pu_bacteria 2795385470 2795782880 202
13 3300005539 Ga0068853_100007909 Ga0068853_1000079095 203
14 3300005616 Ga0068852_100013610 Ga0068852_1000136106 203
15 3300010375 Ga0105239_10564893 Ga0105239_105648931 203
16 3300026041 Ga0207639_10015704 Ga0207639_100157045 203
17 3300050508 nmdc:mga09592_133120_c1 nmdc:mga09592_133120_c1_248_859 203
18 3300005367 Ga0070667_100005427 Ga0070667_10000542711 204
19 3300025986 Ga0207658_10045469 Ga0207658_100454693 204
20 3300044683 Ga0466965_0074397 Ga0466965_0074397_338_952 204
21 3300044684 Ga0466966_0004853 Ga0466966_0004853_770_1384 204
22 3300044694 Ga0466963_0005417 Ga0466963_0005417_6073_6687 204
23 3300044706 Ga0466964_0067059 Ga0466964_0067059_434_1048 204
24 3300044719 Ga0466971_0007213 Ga0466971_0007213_770_1384 204
25 3300044842 Ga0466957_0000944 Ga0466957_0000944_13459_14073 204
26 3300045049 Ga0466959_0006765 Ga0466959_0006765_2387_3001 204
27 3300045836 Ga0466958_0067266 Ga0466958_0067266_655_1269 204
28 3300045976 Ga0466967_0062383 Ga0466967_0062383_1024_1638 204
29 3300045976 Ga0466967_0123025 Ga0466967_0123025_797_1411 204
30 3300061719 Ga0466962_0000231 Ga0466962_0000231_17614_18228 204
31 iso_pu_bacteria 2795385472 2795796269 204
32 3300005435 Ga0070714_100343368 Ga0070714_1003433682 206
33 3300006048 Ga0075363_100291188 Ga0075363_1002911882 206
34 3300048929 Ga0496126_0385147 Ga0496126_0385147_371_991 206
35 3300031838 Ga0307518_10170321 Ga0307518_101703212 207
36 3300005435 Ga0070714_100002007 Ga0070714_1000020077 208
37 3300005436 Ga0070713_100121905 Ga0070713_1001219052 208
38 3300006051 Ga0075364_10027071 Ga0075364_100270713 208
39 3300025928 Ga0207700_10032604 Ga0207700_100326045 208
40 3300025929 Ga0207664_10012873 Ga0207664_100128734 208
41 3300050491 nmdc:mga00v17_34386_c1 nmdc:mga00v17_34386_c1_181_840 208
42 3300045836 Ga0466958_0351379 Ga0466958_0351379_256_888 210
43 iso_pu_bacteria 2523231044 2523382705 210
44 iso_pu_bacteria 2565956761 2566995248 210
45 iso_pu_bacteria 2738541308 2738892484 210
46 iso_pu_bacteria 2751185725 2753035051 210
47 iso_pu_bacteria 2751185792 2753323568 210
48 iso_pu_bacteria 2816332139 2816510568 210
49 iso_pu_bacteria 2842888712 2842891297 210
50 iso_pu_bacteria 2904535858 2904539282 210
51 3300044683 Ga0466965_0226776 Ga0466965_0226776_11_664 211
52 3300044684 Ga0466966_0111713 Ga0466966_0111713_518_1171 211
53 3300044693 Ga0466961_0064699 Ga0466961_0064699_434_1102 211
54 3300044719 Ga0466971_0285105 Ga0466971_0285105_93_761 211
55 3300044735 Ga0466968_0080655 Ga0466968_0080655_482_1150 211
56 3300044765 Ga0466970_0036303 Ga0466970_0036303_348_1016 211
57 3300044842 Ga0466957_0133415 Ga0466957_0133415_391_1059 211
58 3300045049 Ga0466959_0147504 Ga0466959_0147504_520_1188 211
59 3300005435 Ga0070714_100051834 Ga0070714_1000518343 212
60 3300005436 Ga0070713_100038923 Ga0070713_1000389232 212
61 3300005578 Ga0068854_100946166 Ga0068854_1009461661 212
62 3300006173 Ga0070716_100292486 Ga0070716_1002924862 212
63 3300025898 Ga0207692_10058538 Ga0207692_100585383 212
64 3300025939 Ga0207665_10309863 Ga0207665_103098631 212
65 iso_pu_bacteria 2547132424 2548696884 213
66 iso_pu_bacteria 2551306166 2552109060 213
67 iso_pu_bacteria 2643221692 2644512596 213
68 iso_pu_bacteria 2738543005 2739205611 213
69 iso_pu_bacteria 2738543011 2739237207 213
70 iso_pu_bacteria 2738543034 2739361940 213
71 iso_pu_bacteria 2744054611 2744954025 213
72 iso_pu_bacteria 2889300758 2889301433 213
73 iso_pu_bacteria 2904765812 2904769844 213
74 iso_pu_bacteria 2904770941 2904771297 213
75 iso_pu_bacteria 2908811453 2908816108 213
76 iso_pu_bacteria 2919420072 2919423207 213
77 iso_pu_bacteria 2919432681 2919435815 213
78 iso_pu_bacteria 2919713450 2919717505 213
79 iso_pu_bacteria 2928142448 2928144683 213
80 iso_pu_bacteria 2939743619 2939749047 213
81 iso_pu_bacteria 2974315732 2974317482 213
82 iso_pu_bacteria 2984523437 2984525692 213
83 3300006048 Ga0075363_100128955 Ga0075363_1001289552 214
84 3300006051 Ga0075364_10269636 Ga0075364_102696362 214
85 3300006353 Ga0075370_10018375 Ga0075370_100183753 214
86 3300021384 Ga0213876_10056103 Ga0213876_100561032 214
87 3300031251 Ga0265327_10000062 Ga0265327_10000062152 214
88 3300032002 Ga0307416_100718120 Ga0307416_1007181202 214
89 3300037853 Ga0436364_0425919 Ga0436364_0425919_1255_1902 214
90 3300039437 Ga0436365_1666845 Ga0436365_1666845_6463_7110 214
91 3300044656 Ga0466969_0127302 Ga0466969_0127302_68_745 214
92 3300044694 Ga0466963_0279784 Ga0466963_0279784_44_706 214
93 3300046472 Ga0495580_0127064 Ga0495580_0127064_342_1007 214
94 3300046616 Ga0495668_0001622 Ga0495668_0001622_18179_18874 214
95 3300048929 Ga0496126_0278997 Ga0496126_0278997_171_911 214
96 3300050496 nmdc:mga07m45_90171_c1 nmdc:mga07m45_90171_c1_709_1449 214
97 iso_pu_bacteria 2922554459 2922556735 214
98 3300031251 Ga0265327_10000064 Ga0265327_10000064112 215
99 3300031251 Ga0265327_10005264 Ga0265327_100052648 215
100 3300035090 Ga0373949_0104868 Ga0373949_0104868_90_752 215
101 iso_pu_bacteria 2738541274 2738705233 215
102 iso_pu_bacteria 2738543028 2739334797 215
103 iso_pu_bacteria 2902799365 2902801317 215
104 3300049570 Ga0501033_0033920 Ga0501033_0033920_40_708 216
105 3300049571 Ga0501034_0023258 Ga0501034_0023258_2269_2937 216
106 3300049572 Ga0501036_0105280 Ga0501036_0105280_1260_1928 216
107 3300049580 Ga0501046_0301326 Ga0501046_0301326_71_739 216
108 3300049581 Ga0501047_0034848 Ga0501047_0034848_986_1654 216
109 3300049581 Ga0501047_0080620 Ga0501047_0080620_1692_2354 216
110 3300049585 Ga0501069_0025765 Ga0501069_0025765_1511_2173 216
111 3300049822 Ga0501035_0001705 Ga0501035_0001705_10665_11333 216
112 3300049823 Ga0501044_0117956 Ga0501044_0117956_1324_1992 216
113 3300006178 Ga0075367_10283664 Ga0075367_102836642 217
114 3300009148 Ga0105243_10014575 Ga0105243_100145753 217
115 3300021361 Ga0213872_10121510 Ga0213872_101215102 217
116 3300025929 Ga0207664_10042685 Ga0207664_100426853 217
117 3300025935 Ga0207709_10003169 Ga0207709_100031695 217
118 3300039447 Ga0436361_0931192 Ga0436361_0931192_85_756 217
119 3300045976 Ga0466967_0209436 Ga0466967_0209436_255_926 217
120 3300046501 Ga0495607_0037079 Ga0495607_0037079_102_794 217
121 3300047323 Ga0495683_0000599 Ga0495683_0000599_15913_16605 217
122 3300050490 nmdc:mga03n38_48872_c1 nmdc:mga03n38_48872_c1_814_1500 217
123 3300006038 Ga0075365_10091863 Ga0075365_100918633 218
124 3300006186 Ga0075369_10120157 Ga0075369_101201572 218
125 3300003792 Ga0055540_1000065 Ga0055540_100006582 219
126 3300003792 Ga0055540_1000951 Ga0055540_10009513 219
127 3300005539 Ga0068853_100045670 Ga0068853_1000456703 219
128 3300006177 Ga0075362_10248228 Ga0075362_102482282 219
129 3300006186 Ga0075369_10012892 Ga0075369_100128922 219
130 3300009148 Ga0105243_10398379 Ga0105243_103983792 219
131 3300025303 Ga0209051_1004758 Ga0209051_100475810 219
132 3300047320 Ga0495672_0032900 Ga0495672_0032900_2003_2698 219
133 3300048929 Ga0496126_0045997 Ga0496126_0045997_1017_1712 219
134 3300049823 Ga0501044_0028712 Ga0501044_0028712_4548_5210 219
135 3300050516 nmdc:mga0sz30_188412_c1 nmdc:mga0sz30_188412_c1_88_768 219
136 3300050516 nmdc:mga0sz30_211616_c1 nmdc:mga0sz30_211616_c1_170_850 219
137 3300053080 Ga0500635_0065579 Ga0500635_0065579_413_1108 219
138 3300053087 Ga0500643_007146 Ga0500643_007146_1002_1697 219
139 3300053096 Ga0500641_0199319 Ga0500641_0199319_69_749 219
140 3300053131 Ga0500652_018824 Ga0500652_018824_352_1047 219
141 3300053134 Ga0500658_0023880 Ga0500658_0023880_1327_2007 219
142 3300053136 Ga0500559_0072528 Ga0500559_0072528_803_1498 219
143 3300053730 Ga0500645_000171 Ga0500645_000171_27196_27891 219
144 3300053730 Ga0500645_087143 Ga0500645_087143_15_710 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

42

206

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wmv-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.9402 7 209
6wm5-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii 0.9395 6 209
6h53-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in apo form 0.9361 18 209
6h5a-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in complex with manganese and citrate 0.9275 16 210
6h53-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in apo form 0.9267 18 209
ID Description Score Start End Superfamily
af_P9WPG7_9_203_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9569 10 203 1.20.120.1760
af_P9WPG7_9_203_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9474 10 203 1.20.120.1760
5d92A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9083 7 200 1.20.120.1760
5d92A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.858 7 200 1.20.120.1760
4o6mB02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8415 7 200 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A238WZW0-F1-model_v4 Phosphatidylinositol phosphate synthase (PIP synthase) (EC 2.7.8.-) (CDP-diacylglycerol--D-myo-inositol-3-phosphate 3-phosphatidyltransferase) 0.9737 7 202 GO:0000287
GO:0005886
GO:0008654
GO:0016780
AF-A0A2S8MN45-F1-model_v4 deleted 0.9709 44 183
AF-W5W4K3-F1-model_v4 Phosphatidylinositol phosphate synthase (PIP synthase) (EC 2.7.8.-) (CDP-diacylglycerol--D-myo-inositol-3-phosphate 3-phosphatidyltransferase) 0.9637 3 202 GO:0000287
GO:0005886
GO:0008654
GO:0016780
AF-A0A6N7H5B7-F1-model_v4 Phosphatidylinositol phosphate synthase (PIP synthase) (EC 2.7.8.-) (CDP-diacylglycerol--D-myo-inositol-3-phosphate 3-phosphatidyltransferase) 0.9612 7 202 GO:0000287
GO:0005886
GO:0008654
GO:0016780
AF-A0A853BBD9-F1-model_v4 Phosphatidylinositol phosphate synthase (PIP synthase) (EC 2.7.8.-) (CDP-diacylglycerol--D-myo-inositol-3-phosphate 3-phosphatidyltransferase) 0.9592 27 202 GO:0000287
GO:0005886
GO:0008654
GO:0016780

Feature Viewer

pLDDT pTM Quality
89.55 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map