F196294

General Info

Members Datasets Scaffolds Average Seq Length
146 101 292 117

Family's Representative Sequence

Representative Sequence 3300002738|JGI25154J39366_1002007|JGI25154J39366_10020078
Length 131
Sequence VARNAALSYGEGMETLRHIVLFVHLIGFAVLFGAWAAQAFGGKRVFTRLMTIGMTIAAVAGLALAAPWGLPEGVEMNYAKIGTKLVILLVIGALLGIGTARQKRDQVVPPAIFWLVGILTAVNAAIAAIWR

Samples

Sample ID Description Type Environment
1 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
6 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
7 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
8 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
9 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
10 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
11 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
12 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
13 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
14 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
15 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
16 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
17 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
18 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
19 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
20 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
25 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
26 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
27 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
28 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
29 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
30 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
31 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
32 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
33 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
34 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
35 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
36 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
37 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
38 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
39 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
40 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
41 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
42 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
43 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
44 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
45 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
46 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
47 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
48 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
49 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
50 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
51 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
52 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
53 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
54 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
55 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
56 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
57 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
61 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
62 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
63 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
64 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
65 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 2643221566 Microbacterium sp. Root166 Isolate Unclassified
67 2643221597 Microbacterium sp. Root180 Isolate Unclassified
68 2643221630 Microbacterium sp. Root322 Isolate Unclassified
69 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
70 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
71 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
72 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
73 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
74 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
75 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
76 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
77 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
78 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
79 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
80 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
81 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
82 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
83 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
84 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
85 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
86 2919069694 Microbacterium sp. 1154 Isolate Unclassified
87 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
88 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
89 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
90 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
91 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
92 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
93 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
94 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
95 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
96 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
97 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
98 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
99 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
100 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
101 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.29
Metatranscriptomes 2.05
Isolates 24.66

Biome Distribution

Category Percentage (%)
Aerial Root 1.37
Bulb 0
Endosphere 8.22
Nodule 0
Rhizoplane 2.74
Rhizosphere 54.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1002007 3300002738 Bacteria 5906
2 JGI24740J21852_10003984 3300001979 Bacteria 6408
3 Ga0006562J51391_1025823 3300003578 Bacteria 5000
4 Ga0006562J51391_1025824 3300003578 Bacteria 3249
5 Ga0070667_100070269 3300005367 Bacteria 2980
6 Ga0068867_101692309 3300005459 Bacteria 593
7 Ga0068852_101340560 3300005616 Bacteria 737
8 Ga0075364_10032159 3300006051 Bacteria 3371
9 Ga0075364_10316780 3300006051 Bacteria 1062
10 Ga0075364_10369562 3300006051 Bacteria 978
11 Ga0075364_10398550 3300006051 Bacteria 939
12 Ga0075369_10182792 3300006186 Bacteria 965
13 Ga0075370_10163656 3300006353 Bacteria 1306
14 Ga0105244_10077386 3300009036 Bacteria 1650
15 Ga0105243_10013851 3300009148 Bacteria 6104
16 Ga0105243_10059444 3300009148 Bacteria 3051
17 Ga0105243_11466297 3300009148 Bacteria 705
18 Ga0157370_10596927 3300013104 Bacteria 1011
19 Ga0157370_11652132 3300013104 Bacteria 575
20 Ga0157370_11709171 3300013104 Bacteria 565
21 Ga0157369_10955361 3300013105 Bacteria 878
22 Ga0157369_12524196 3300013105 Bacteria 520
23 Ga0171462_1001 3300013250 Bacteria 1135406
24 Ga0163162_12900877 3300013306 Bacteria 552
25 Ga0157375_11285014 3300013308 Bacteria 860
26 Ga0163161_10125222 3300017792 Bacteria 1934
27 Ga0209646_1000092 3300025246 Bacteria 185930
28 Ga0209129_1067595 3300025258 Bacteria 520
29 Ga0207655_1006390 3300025728 Bacteria 7821
30 Ga0207709_10007515 3300025935 Bacteria 6062
31 Ga0207709_10030694 3300025935 Bacteria 3129
32 Ga0207661_11818166 3300025944 Bacteria 555
33 Ga0207658_10083803 3300025986 Bacteria 2452
34 Ga0307408_100858307 3300031548 Bacteria 828
35 Ga0307405_10039935 3300031731 Bacteria 2840
36 Ga0307405_10274023 3300031731 Bacteria 1267
37 Ga0307413_10881276 3300031824 Bacteria 759
38 Ga0307406_10000115 3300031901 Bacteria 46616
39 Ga0307406_10013907 3300031901 Bacteria 4620
40 Ga0307406_10022279 3300031901 Bacteria 3756
41 Ga0307406_10053088 3300031901 Bacteria 2581
42 Ga0307406_10082613 3300031901 Bacteria 2140
43 Ga0307406_10487950 3300031901 Bacteria 996
44 Ga0307406_10852929 3300031901 Bacteria 772
45 Ga0307406_11297189 3300031901 Bacteria 635
46 Ga0307409_100329281 3300031995 Bacteria 1433
47 Ga0307409_100424217 3300031995 Bacteria 1277
48 Ga0307409_101306736 3300031995 Bacteria 750
49 Ga0307409_102677795 3300031995 Bacteria 527
50 Ga0307416_101059851 3300032002 Bacteria 915
51 Ga0307414_10036031 3300032004 Bacteria 3299
52 Ga0307414_10217300 3300032004 Bacteria 1567
53 Ga0307414_10371567 3300032004 Bacteria 1233
54 Ga0307414_10870080 3300032004 Bacteria 825
55 Ga0307414_10984656 3300032004 Bacteria 776
56 Ga0307414_12126848 3300032004 Bacteria 524
57 Ga0307415_100717047 3300032126 Bacteria 904
58 Ga0439465_0160605 3300041413 Bacteria 806
59 Ga0451791_0614670 3300041451 Bacteria 512
60 Ga0451806_769178 3300041462 Bacteria 864
61 Ga0451835_0979463 3300041492 Bacteria 530
62 Ga0451853_0795555 3300041512 Bacteria 563
63 Ga0451853_2086418 3300041512 Bacteria 721
64 Ga0451853_2337466 3300041512 Bacteria 1038
65 Ga0451853_2429372 3300041512 Bacteria 560
66 Ga0466972_0040921 3300044658 Bacteria 2257
67 Ga0466965_0074996 3300044683 Bacteria 1705
68 Ga0466968_0055395 3300044735 Bacteria 1701
69 Ga0466960_0102840 3300044901 Bacteria 1474
70 Ga0466960_0167634 3300044901 Bacteria 1183
71 Ga0495627_000262 3300046453 Bacteria 53953
72 Ga0495650_0255967 3300046471 Bacteria 594
73 Ga0495643_0434082 3300046522 Bacteria 574
74 Ga0495649_0251694 3300046694 Bacteria 907
75 Ga0496104_0271119 3300048907 Bacteria 1610
76 Ga0496114_1124265 3300048917 Bacteria 671
77 Ga0496117_0000028 3300048920 Bacteria 407392
78 Ga0496117_0267757 3300048920 Bacteria 922
79 Ga0496118_0276622 3300048921 Bacteria 937
80 Ga0496119_0001581 3300048922 Bacteria 27095
81 Ga0496119_0005773 3300048922 Bacteria 11720
82 Ga0496119_0052167 3300048922 Bacteria 2507
83 Ga0496120_0000697 3300048923 Bacteria 49216
84 Ga0496120_0003997 3300048923 Bacteria 12816
85 Ga0496122_0012014 3300048925 Bacteria 8683
86 Ga0496122_0056200 3300048925 Bacteria 2936
87 Ga0496123_0000718 3300048926 Bacteria 54060
88 Ga0496124_0014232 3300048927 Bacteria 7707
89 Ga0496124_0037467 3300048927 Bacteria 4217
90 Ga0496124_0465281 3300048927 Bacteria 858
91 Ga0496125_0000242 3300048928 Bacteria 112000
92 Ga0496125_0005927 3300048928 Bacteria 13388
93 Ga0496125_0078822 3300048928 Bacteria 2530
94 Ga0496125_0103555 3300048928 Bacteria 2088
95 Ga0496126_0003248 3300048929 Bacteria 20774
96 Ga0496126_0112781 3300048929 Bacteria 2367
97 Ga0501032_0329477 3300049569 Bacteria 985
98 Ga0501034_0010777 3300049571 Bacteria 9495
99 Ga0501034_0027101 3300049571 Bacteria 5829
100 Ga0501038_0015408 3300049574 Bacteria 6950
101 Ga0501038_0103607 3300049574 Bacteria 2366
102 Ga0501039_0207753 3300049575 Bacteria 1539
103 Ga0501070_0000372 3300049586 Bacteria 40805
104 Ga0501075_0475597 3300049591 Bacteria 953
105 nmdc:mga00v17_18534_c1 3300050491 Bacteria 3956
106 nmdc:mga00v17_296338_c1 3300050491 Bacteria 1050
107 nmdc:mga00v17_395373_c1 3300050491 Bacteria 898
108 nmdc:mga07m45_598240_c1 3300050496 Bacteria 637
109 nmdc:mga0sz30_225259_c1 3300050516 Bacteria 834
110 Ga0587101_037228 3300059623 Bacteria 787
111 2643846461 2643221566 Bacteria 3460379
112 2643996590 2643221597 Bacteria 3347721
113 2644170981 2643221630 Bacteria 3601215
114 2644679399 2643221724 Bacteria 3593515
115 2723642994 2721755702 Bacteria 4373124
116 2730228908 2728369380 Bacteria 3620317
117 2747955012 2747842429 Bacteria 3914386
118 2758224550 2757320536 Bacteria 3629334
119 2774378668 2773857758 Bacteria 3592392
120 2774400373 2773857763 Bacteria 4180068
121 2808884929 2808606368 Bacteria 3174172
122 2812322320 2811994872 Bacteria 4121241
123 2821269243 2821268502 Bacteria 3750023
124 2833710145 2833709550 Bacteria 4008291
125 2852646642 2852646457 Bacteria 3408613
126 2852664481 2852663356 Bacteria 4090475
127 2857722236 2857720070 Bacteria 3189373
128 2870629607 2870628048 Bacteria 3696012
129 2904510161 2904509784 Bacteria 3520416
130 2908678620 2908678064 Bacteria 3482747
131 2919070971 2919069694 Bacteria 3622919
132 2928091080 2928090899 Bacteria 3158267
133 2945971054 2945968032 Bacteria 4111363
134 2946034548 2946033335 Bacteria 3835514
135 2946043402 2946041624 Bacteria 4191385
136 2946081659 2946080515 Bacteria 4310960
137 2974298174 2974294766 Bacteria 3767688
138 2974325591 2974324384 Bacteria 3750535
139 2977230516 2977228692 Bacteria 3450105
140 2977239317 2977236895 Bacteria 3569373
141 2984542898 2984542743 Bacteria 3569378
142 2984582161 2984580707 Bacteria 3351387
143 8004183744 8004182704 Bacteria 3391155
144 8016254824 8016254467 Bacteria 3797036
145 8045832862 8045830549 Bacteria 4444727
146 8046355370 8046352972 Bacteria 3613806
147 JGI25154J39366_1002007
148 JGI24740J21852_10003984
149 Ga0006562J51391_1025823
150 Ga0006562J51391_1025824
151 Ga0070667_100070269
152 Ga0068867_101692309
153 Ga0068852_101340560
154 Ga0075364_10032159
155 Ga0075364_10316780
156 Ga0075364_10369562
157 Ga0075364_10398550
158 Ga0075369_10182792
159 Ga0075370_10163656
160 Ga0105244_10077386
161 Ga0105243_10013851
162 Ga0105243_10059444
163 Ga0105243_11466297
164 Ga0157370_10596927
165 Ga0157370_11652132
166 Ga0157370_11709171
167 Ga0157369_10955361
168 Ga0157369_12524196
169 Ga0171462_1001
170 Ga0163162_12900877
171 Ga0157375_11285014
172 Ga0163161_10125222
173 Ga0209646_1000092
174 Ga0209129_1067595
175 Ga0207655_1006390
176 Ga0207709_10007515
177 Ga0207709_10030694
178 Ga0207661_11818166
179 Ga0207658_10083803
180 Ga0307408_100858307
181 Ga0307405_10039935
182 Ga0307405_10274023
183 Ga0307413_10881276
184 Ga0307406_10000115
185 Ga0307406_10013907
186 Ga0307406_10022279
187 Ga0307406_10053088
188 Ga0307406_10082613
189 Ga0307406_10487950
190 Ga0307406_10852929
191 Ga0307406_11297189
192 Ga0307409_100329281
193 Ga0307409_100424217
194 Ga0307409_101306736
195 Ga0307409_102677795
196 Ga0307416_101059851
197 Ga0307414_10036031
198 Ga0307414_10217300
199 Ga0307414_10371567
200 Ga0307414_10870080
201 Ga0307414_10984656
202 Ga0307414_12126848
203 Ga0307415_100717047
204 Ga0439465_0160605
205 Ga0451791_0614670
206 Ga0451806_769178
207 Ga0451835_0979463
208 Ga0451853_0795555
209 Ga0451853_2086418
210 Ga0451853_2337466
211 Ga0451853_2429372
212 Ga0466972_0040921
213 Ga0466965_0074996
214 Ga0466968_0055395
215 Ga0466960_0102840
216 Ga0466960_0167634
217 Ga0495627_000262
218 Ga0495650_0255967
219 Ga0495643_0434082
220 Ga0495649_0251694
221 Ga0496104_0271119
222 Ga0496114_1124265
223 Ga0496117_0000028
224 Ga0496117_0267757
225 Ga0496118_0276622
226 Ga0496119_0001581
227 Ga0496119_0005773
228 Ga0496119_0052167
229 Ga0496120_0000697
230 Ga0496120_0003997
231 Ga0496122_0012014
232 Ga0496122_0056200
233 Ga0496123_0000718
234 Ga0496124_0014232
235 Ga0496124_0037467
236 Ga0496124_0465281
237 Ga0496125_0000242
238 Ga0496125_0005927
239 Ga0496125_0078822
240 Ga0496125_0103555
241 Ga0496126_0003248
242 Ga0496126_0112781
243 Ga0501032_0329477
244 Ga0501034_0010777
245 Ga0501034_0027101
246 Ga0501038_0015408
247 Ga0501038_0103607
248 Ga0501039_0207753
249 Ga0501070_0000372
250 Ga0501075_0475597
251 nmdc:mga00v17_18534_c1
252 nmdc:mga00v17_296338_c1
253 nmdc:mga00v17_395373_c1
254 nmdc:mga07m45_598240_c1
255 nmdc:mga0sz30_225259_c1
256 Ga0587101_037228
257 2643846461
258 2643996590
259 2644170981
260 2644679399
261 2723642994
262 2730228908
263 2747955012
264 2758224550
265 2774378668
266 2774400373
267 2808884929
268 2812322320
269 2821269243
270 2833710145
271 2852646642
272 2852664481
273 2857722236
274 2870629607
275 2904510161
276 2908678620
277 2919070971
278 2928091080
279 2945971054
280 2946034548
281 2946043402
282 2946081659
283 2974298174
284 2974325591
285 2977230516
286 2977239317
287 2984542898
288 2984582161
289 8004183744
290 8016254824
291 8045832862
292 8046355370

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zl9-assembly1.cif.gz_A crystal structure of human gpcr niacin receptor (hca2) 0.7876 5 116
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.7323 1 116
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.7 1 116
6iui-assembly2.cif.gz_B crystal structure of git1 pbd domain in complex with paxillin ld4 motif 0.6609 1 116
5l31-assembly1.cif.gz_C crystal structure of an engineered metal-free ridc1 variant containing five disulfide bonds. 0.6517 5 118
ID Description Score Start End Superfamily
2yfbB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.7553 12 116 1.20.1440.210
2yfbA01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.7443 5 116 1.20.1440.210
2yfaB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.7437 8 116 1.20.1440.210
af_Q6H474_2_116_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.7249 5 115 1.20.120.290
af_Q93483_1_234_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.7162 5 116 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A846SEV1-F1-model_v4 Fe-S protein 0.9943 1 118 GO:0016020
AF-A0A0U4FLG1-F1-model_v4 deleted 0.9925 1 118
AF-A0A2V4NWZ5-F1-model_v4 deleted 0.9906 1 118
AF-A0A846SEV1-F1-model_v4 Fe-S protein 0.9775 1 118 GO:0016020
AF-A0A0U4FLG1-F1-model_v4 deleted 0.9676 1 118

Map