F197207
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 146 | 112 | 146 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10053996|Ga0075365_100539961 |
| Length | 248 |
| Sequence | VSRRNFIPAGGSFAALAVAVAVVPLLSGCGVSTKGDFNRGKQLFAAQCSTCHALKDAGSTSTIGPNLDAAFSQARASGMDPETIAGVVKNQVENPRPAEETTGGANPSVSMPADLVTGEDLDDVASYLGTVAGNPEFKGPSLPDDPGALVFSQNNCAGCHTLEAAGASGTTGPDLDSAVPNDLKTASAVREAIVDPNKRIAPGFPPNVMPQTYGQEISSQDLNALVQFLLKCSGKGAQTAPCQPTSGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 15 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 26 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 27 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 31 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 32 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 45 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 64 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 65 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 66 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 67 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 68 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 69 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 70 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 71 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 72 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 73 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 74 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 92 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 93 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 94 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 95 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 96 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 97 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 98 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 99 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 100 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 101 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 102 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 103 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 104 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 106 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 107 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.32 |
| Metatranscriptomes | 0.68 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.37 |
| Nodule | 0 |
| Rhizoplane | 13.7 |
| Rhizosphere | 82.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000113 | 3300001977 | Bacteria | 9482 |
| 2 | Ga0070658_10081497 | 3300005327 | Bacteria | 2658 |
| 3 | Ga0070683_100006417 | 3300005329 | Bacteria | 9863 |
| 4 | Ga0070682_100000026 | 3300005337 | Bacteria | 191388 |
| 5 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 6 | Ga0070668_100023112 | 3300005347 | Bacteria | 4700 |
| 7 | Ga0070675_100000050 | 3300005354 | Bacteria | 72016 |
| 8 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 9 | Ga0070688_100000010 | 3300005365 | Bacteria | 84103 |
| 10 | Ga0070659_100003678 | 3300005366 | Bacteria | 10933 |
| 11 | Ga0070667_100037746 | 3300005367 | Bacteria | 4050 |
| 12 | Ga0070714_100014187 | 3300005435 | Bacteria | 6397 |
| 13 | Ga0070711_100268238 | 3300005439 | Bacteria | 1346 |
| 14 | Ga0068867_100000078 | 3300005459 | Bacteria | 59729 |
| 15 | Ga0070685_10000010 | 3300005466 | Bacteria | 146946 |
| 16 | Ga0070684_100535636 | 3300005535 | Bacteria | 1086 |
| 17 | Ga0068853_100007596 | 3300005539 | Bacteria | 8682 |
| 18 | Ga0070672_100000031 | 3300005543 | Bacteria | 62241 |
| 19 | Ga0070664_100024741 | 3300005564 | Bacteria | 4971 |
| 20 | Ga0068857_100872954 | 3300005577 | Bacteria | 862 |
| 21 | Ga0068854_100000082 | 3300005578 | Bacteria | 68340 |
| 22 | Ga0068856_100000136 | 3300005614 | Bacteria | 74026 |
| 23 | Ga0068856_100013363 | 3300005614 | Bacteria | 7950 |
| 24 | Ga0070702_100054974 | 3300005615 | Bacteria | 2293 |
| 25 | Ga0068852_100000994 | 3300005616 | Bacteria | 18720 |
| 26 | Ga0068866_10000206 | 3300005718 | Bacteria | 27716 |
| 27 | Ga0068851_10001071 | 3300005834 | Bacteria | 11849 |
| 28 | Ga0081455_10004942 | 3300005937 | Bacteria | 14737 |
| 29 | Ga0081455_10073005 | 3300005937 | Bacteria | 2838 |
| 30 | Ga0081538_10170516 | 3300005981 | Bacteria | 950 |
| 31 | Ga0081540_1001098 | 3300005983 | Bacteria | 23963 |
| 32 | Ga0075365_10053996 | 3300006038 | Bacteria | 2663 |
| 33 | Ga0075433_10020200 | 3300006852 | Bacteria | 5565 |
| 34 | Ga0068865_100001495 | 3300006881 | Bacteria | 13634 |
| 35 | Ga0105245_10038238 | 3300009098 | Bacteria | 4270 |
| 36 | Ga0105245_10104770 | 3300009098 | Bacteria | 2623 |
| 37 | Ga0105241_10116429 | 3300009174 | Bacteria | 2146 |
| 38 | Ga0105242_10000063 | 3300009176 | Bacteria | 74721 |
| 39 | Ga0105242_10061550 | 3300009176 | Bacteria | 3087 |
| 40 | Ga0105239_10295715 | 3300010375 | Bacteria | 1823 |
| 41 | Ga0105239_10366021 | 3300010375 | Bacteria | 1629 |
| 42 | Ga0157371_10004888 | 3300013102 | Bacteria | 11513 |
| 43 | Ga0157370_10262774 | 3300013104 | Bacteria | 1595 |
| 44 | Ga0157369_10001730 | 3300013105 | Bacteria | 26528 |
| 45 | Ga0157374_10101946 | 3300013296 | Bacteria | 2752 |
| 46 | Ga0157378_10016178 | 3300013297 | Bacteria | 6532 |
| 47 | Ga0157372_10000146 | 3300013307 | Bacteria | 77952 |
| 48 | Ga0163161_10008446 | 3300017792 | Bacteria | 7130 |
| 49 | Ga0206356_10666627 | 3300020070 | Bacteria | 2422 |
| 50 | Ga0207656_10001283 | 3300025321 | Bacteria | 8251 |
| 51 | Ga0207642_10000473 | 3300025899 | Bacteria | 12319 |
| 52 | Ga0207705_10162574 | 3300025909 | Bacteria | 1678 |
| 53 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 54 | Ga0207650_10030751 | 3300025925 | Bacteria | 3871 |
| 55 | Ga0207659_10000055 | 3300025926 | Bacteria | 74252 |
| 56 | Ga0207687_10020955 | 3300025927 | Bacteria | 4339 |
| 57 | Ga0207664_10015535 | 3300025929 | Bacteria | 5529 |
| 58 | Ga0207690_10002537 | 3300025932 | Bacteria | 11031 |
| 59 | Ga0207686_10000230 | 3300025934 | Bacteria | 42566 |
| 60 | Ga0207686_10030532 | 3300025934 | Bacteria | 3192 |
| 61 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 62 | Ga0207704_10000104 | 3300025938 | Bacteria | 46614 |
| 63 | Ga0207691_10000178 | 3300025940 | Bacteria | 60110 |
| 64 | Ga0207661_10002281 | 3300025944 | Bacteria | 13216 |
| 65 | Ga0207679_10018802 | 3300025945 | Bacteria | 4635 |
| 66 | Ga0207640_10000054 | 3300025981 | Bacteria | 95136 |
| 67 | Ga0207702_10000105 | 3300026078 | Bacteria | 97835 |
| 68 | Ga0207702_10001788 | 3300026078 | Bacteria | 21174 |
| 69 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 70 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 71 | Ga0265338_10000287 | 3300028800 | Bacteria | 90818 |
| 72 | Ga0265325_10028601 | 3300031241 | Bacteria | 3003 |
| 73 | Ga0395899_0227118 | 3300037312 | Bacteria | 1291 |
| 74 | Ga0395900_0106096 | 3300037418 | Bacteria | 2886 |
| 75 | Ga0395900_0119968 | 3300037418 | Bacteria | 2699 |
| 76 | Ga0395900_0164100 | 3300037418 | Bacteria | 2265 |
| 77 | Ga0395900_0185352 | 3300037418 | Bacteria | 2113 |
| 78 | Ga0395900_0568550 | 3300037418 | Bacteria | 1077 |
| 79 | Ga0395898_0039160 | 3300037466 | Bacteria | 4693 |
| 80 | Ga0395898_0167573 | 3300037466 | Bacteria | 2100 |
| 81 | Ga0395898_0299959 | 3300037466 | Bacteria | 1533 |
| 82 | Ga0395905_0243357 | 3300037471 | Bacteria | 1681 |
| 83 | Ga0395901_0259393 | 3300038443 | Bacteria | 1809 |
| 84 | Ga0395901_0440394 | 3300038443 | Bacteria | 1334 |
| 85 | Ga0451853_1257484 | 3300041512 | Bacteria | 3450 |
| 86 | Ga0451853_2761787 | 3300041512 | Bacteria | 1777 |
| 87 | Ga0451853_2804839 | 3300041512 | Bacteria | 2000 |
| 88 | Ga0466957_0001268 | 3300044842 | Bacteria | 13149 |
| 89 | Ga0466967_0000002 | 3300045976 | Bacteria | 219994 |
| 90 | Ga0495592_0171040 | 3300046454 | Bacteria | 1488 |
| 91 | Ga0495629_0050917 | 3300046459 | Bacteria | 2899 |
| 92 | Ga0495662_0002052 | 3300046476 | Bacteria | 10100 |
| 93 | Ga0495606_0000017 | 3300046507 | Bacteria | 284549 |
| 94 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 95 | Ga0495628_0003421 | 3300046516 | Bacteria | 14207 |
| 96 | Ga0495628_0092510 | 3300046516 | Bacteria | 2339 |
| 97 | Ga0495630_0000032 | 3300046517 | Bacteria | 134425 |
| 98 | Ga0495652_0000018 | 3300046529 | Bacteria | 201634 |
| 99 | Ga0495587_0000272 | 3300046536 | Bacteria | 36939 |
| 100 | Ga0495587_0066517 | 3300046536 | Bacteria | 2102 |
| 101 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 102 | Ga0495613_0000027 | 3300046689 | Bacteria | 146674 |
| 103 | Ga0495624_0000123 | 3300046690 | Bacteria | 54291 |
| 104 | Ga0495604_0000723 | 3300047317 | Bacteria | 27948 |
| 105 | Ga0495604_0023180 | 3300047317 | Bacteria | 4954 |
| 106 | Ga0495680_0103038 | 3300047322 | Bacteria | 2124 |
| 107 | Ga0495675_0000002 | 3300047444 | Bacteria | 216469 |
| 108 | Ga0495679_048025 | 3300047446 | Bacteria | 1292 |
| 109 | Ga0495602_0000034 | 3300048088 | Bacteria | 140722 |
| 110 | Ga0495602_0009482 | 3300048088 | Bacteria | 10121 |
| 111 | Ga0496102_0000749 | 3300048905 | Bacteria | 31723 |
| 112 | Ga0496103_0003112 | 3300048906 | Bacteria | 10202 |
| 113 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 114 | Ga0496104_0214342 | 3300048907 | Bacteria | 1837 |
| 115 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 116 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 117 | Ga0496108_0039188 | 3300048911 | Bacteria | 3950 |
| 118 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 119 | Ga0496109_0000221 | 3300048912 | Bacteria | 56054 |
| 120 | Ga0496109_0162586 | 3300048912 | Bacteria | 2092 |
| 121 | Ga0496110_0000052 | 3300048913 | Bacteria | 58549 |
| 122 | Ga0496110_0017911 | 3300048913 | Bacteria | 5931 |
| 123 | Ga0496110_0116709 | 3300048913 | Bacteria | 2403 |
| 124 | Ga0496110_0127942 | 3300048913 | Bacteria | 2292 |
| 125 | Ga0496111_0005704 | 3300048914 | Bacteria | 8021 |
| 126 | Ga0496111_0021345 | 3300048914 | Bacteria | 4521 |
| 127 | Ga0496111_0024236 | 3300048914 | Bacteria | 4270 |
| 128 | Ga0496112_0000026 | 3300048915 | Bacteria | 144758 |
| 129 | Ga0496112_0021401 | 3300048915 | Bacteria | 6150 |
| 130 | Ga0496113_0000005 | 3300048916 | Bacteria | 105956 |
| 131 | Ga0496120_0055981 | 3300048923 | Bacteria | 2228 |
| 132 | Ga0501042_0175217 | 3300049578 | Bacteria | 1547 |
| 133 | Ga0501070_0455839 | 3300049586 | Bacteria | 1031 |
| 134 | Ga0501072_0283885 | 3300049588 | Bacteria | 1317 |
| 135 | nmdc:mga06r32_35648_c1 | 3300050510 | Bacteria | 4695 |
| 136 | nmdc:mga0a205_55222_c1 | 3300050515 | Bacteria | 3836 |
| 137 | Ga0495601_0000017 | 3300053077 | Bacteria | 204209 |
| 138 | Ga0495612_0008866 | 3300053078 | Bacteria | 4074 |
| 139 | Ga0495612_0010356 | 3300053078 | Bacteria | 3772 |
| 140 | Ga0495655_0000258 | 3300053083 | Bacteria | 9877 |
| 141 | Ga0495655_0001219 | 3300053083 | Bacteria | 3972 |
| 142 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 143 | Ga0495595_0007746 | 3300053084 | Bacteria | 4398 |
| 144 | Ga0495619_0000026 | 3300053085 | Bacteria | 167387 |
| 145 | Ga0495619_0000088 | 3300053085 | Bacteria | 69615 |
| 146 | Ga0500628_000072 | 3300053129 | Bacteria | 26251 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006881 | Ga0068865_100001495 | Ga0068865_10000149511 | 187 |
| 2 | 3300025938 | Ga0207704_10000104 | Ga0207704_1000010418 | 187 |
| 3 | 3300013104 | Ga0157370_10262774 | Ga0157370_102627742 | 193 |
| 4 | 3300005834 | Ga0068851_10001071 | Ga0068851_1000107110 | 194 |
| 5 | 3300025321 | Ga0207656_10001283 | Ga0207656_100012832 | 194 |
| 6 | 3300046507 | Ga0495606_0000017 | Ga0495606_0000017_55572_56267 | 194 |
| 7 | 3300028563 | Ga0265319_1000010 | Ga0265319_100001046 | 197 |
| 8 | 3300028800 | Ga0265338_10000287 | Ga0265338_1000028763 | 197 |
| 9 | 3300031241 | Ga0265325_10028601 | Ga0265325_100286015 | 197 |
| 10 | 3300013307 | Ga0157372_10000146 | Ga0157372_100001469 | 198 |
| 11 | 3300048913 | Ga0496110_0000052 | Ga0496110_0000052_18676_19389 | 198 |
| 12 | 3300048914 | Ga0496111_0005704 | Ga0496111_0005704_1287_2000 | 198 |
| 13 | 3300009174 | Ga0105241_10116429 | Ga0105241_101164292 | 200 |
| 14 | 3300005535 | Ga0070684_100535636 | Ga0070684_1005356361 | 203 |
| 15 | 3300005564 | Ga0070664_100024741 | Ga0070664_1000247412 | 203 |
| 16 | 3300025945 | Ga0207679_10018802 | Ga0207679_100188027 | 203 |
| 17 | 3300005365 | Ga0070688_100000010 | Ga0070688_10000001012 | 204 |
| 18 | 3300005466 | Ga0070685_10000010 | Ga0070685_10000010115 | 204 |
| 19 | 3300046476 | Ga0495662_0002052 | Ga0495662_0002052_3983_4696 | 205 |
| 20 | 3300049586 | Ga0501070_0455839 | Ga0501070_0455839_264_956 | 205 |
| 21 | 3300005937 | Ga0081455_10073005 | Ga0081455_100730052 | 206 |
| 22 | 3300053078 | Ga0495612_0010356 | Ga0495612_0010356_2624_3316 | 206 |
| 23 | 3300045976 | Ga0466967_0000002 | Ga0466967_0000002_30285_30995 | 208 |
| 24 | 3300037418 | Ga0395900_0119968 | Ga0395900_0119968_1158_1922 | 210 |
| 25 | 3300038443 | Ga0395901_0440394 | Ga0395901_0440394_504_1268 | 210 |
| 26 | 3300048915 | Ga0496112_0021401 | Ga0496112_0021401_1057_1767 | 210 |
| 27 | 3300048916 | Ga0496113_0000005 | Ga0496113_0000005_89974_90684 | 210 |
| 28 | 3300005344 | Ga0070661_100000004 | Ga0070661_100000004234 | 211 |
| 29 | 3300005354 | Ga0070675_100000050 | Ga0070675_10000005036 | 211 |
| 30 | 3300013297 | Ga0157378_10016178 | Ga0157378_100161785 | 211 |
| 31 | 3300025920 | Ga0207649_10000003 | Ga0207649_1000000325 | 211 |
| 32 | 3300025926 | Ga0207659_10000055 | Ga0207659_1000005538 | 211 |
| 33 | 3300005435 | Ga0070714_100014187 | Ga0070714_1000141874 | 212 |
| 34 | 3300005981 | Ga0081538_10170516 | Ga0081538_101705161 | 212 |
| 35 | 3300005983 | Ga0081540_1001098 | Ga0081540_10010985 | 212 |
| 36 | 3300025929 | Ga0207664_10015535 | Ga0207664_100155357 | 212 |
| 37 | 3300037312 | Ga0395899_0227118 | Ga0395899_0227118_148_891 | 212 |
| 38 | 3300037418 | Ga0395900_0185352 | Ga0395900_0185352_1049_1792 | 212 |
| 39 | 3300037466 | Ga0395898_0167573 | Ga0395898_0167573_427_1170 | 212 |
| 40 | 3300037466 | Ga0395898_0299959 | Ga0395898_0299959_135_800 | 212 |
| 41 | 3300037471 | Ga0395905_0243357 | Ga0395905_0243357_804_1547 | 212 |
| 42 | 3300038443 | Ga0395901_0259393 | Ga0395901_0259393_68_811 | 212 |
| 43 | 3300041512 | Ga0451853_1257484 | Ga0451853_1257484_1981_2745 | 212 |
| 44 | 3300005616 | Ga0068852_100000994 | Ga0068852_1000009942 | 213 |
| 45 | 3300026142 | Ga0207698_10000015 | Ga0207698_10000015102 | 213 |
| 46 | 3300037418 | Ga0395900_0164100 | Ga0395900_0164100_1312_2073 | 214 |
| 47 | 3300037466 | Ga0395898_0039160 | Ga0395898_0039160_709_1470 | 214 |
| 48 | 3300005615 | Ga0070702_100054974 | Ga0070702_1000549742 | 215 |
| 49 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_433225_433935 | 215 |
| 50 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_101157_101867 | 215 |
| 51 | 3300048911 | Ga0496108_0039188 | Ga0496108_0039188_2923_3624 | 216 |
| 52 | 3300048912 | Ga0496109_0000221 | Ga0496109_0000221_45938_46639 | 216 |
| 53 | 3300005329 | Ga0070683_100006417 | Ga0070683_1000064175 | 217 |
| 54 | 3300005439 | Ga0070711_100268238 | Ga0070711_1002682381 | 217 |
| 55 | 3300025925 | Ga0207650_10030751 | Ga0207650_100307515 | 217 |
| 56 | 3300025944 | Ga0207661_10002281 | Ga0207661_100022818 | 217 |
| 57 | 3300048913 | Ga0496110_0116709 | Ga0496110_0116709_254_964 | 217 |
| 58 | 3300048914 | Ga0496111_0021345 | Ga0496111_0021345_2755_3465 | 217 |
| 59 | 3300005543 | Ga0070672_100000031 | Ga0070672_10000003161 | 219 |
| 60 | 3300009176 | Ga0105242_10000063 | Ga0105242_1000006345 | 219 |
| 61 | 3300020070 | Ga0206356_10666627 | Ga0206356_106666272 | 219 |
| 62 | 3300025934 | Ga0207686_10000230 | Ga0207686_1000023045 | 219 |
| 63 | 3300025940 | Ga0207691_10000178 | Ga0207691_1000017824 | 219 |
| 64 | 3300037418 | Ga0395900_0106096 | Ga0395900_0106096_1463_2182 | 219 |
| 65 | 3300037418 | Ga0395900_0568550 | Ga0395900_0568550_198_887 | 219 |
| 66 | 3300048907 | Ga0496104_0214342 | Ga0496104_0214342_888_1598 | 219 |
| 67 | 3300005327 | Ga0070658_10081497 | Ga0070658_100814972 | 220 |
| 68 | 3300009098 | Ga0105245_10104770 | Ga0105245_101047703 | 220 |
| 69 | 3300025909 | Ga0207705_10162574 | Ga0207705_101625742 | 220 |
| 70 | 3300046517 | Ga0495630_0000032 | Ga0495630_0000032_73045_73740 | 220 |
| 71 | 3300053085 | Ga0495619_0000088 | Ga0495619_0000088_48776_49489 | 220 |
| 72 | 3300005347 | Ga0070668_100023112 | Ga0070668_1000231126 | 222 |
| 73 | 3300005459 | Ga0068867_100000078 | Ga0068867_10000007837 | 222 |
| 74 | 3300005937 | Ga0081455_10004942 | Ga0081455_100049425 | 222 |
| 75 | 3300006852 | Ga0075433_10020200 | Ga0075433_100202007 | 222 |
| 76 | 3300046516 | Ga0495628_0092510 | Ga0495628_0092510_789_1502 | 222 |
| 77 | 3300046690 | Ga0495624_0000123 | Ga0495624_0000123_8984_9727 | 222 |
| 78 | 3300005356 | Ga0070674_100000002 | Ga0070674_10000000240 | 223 |
| 79 | 3300005718 | Ga0068866_10000206 | Ga0068866_1000020618 | 223 |
| 80 | 3300009176 | Ga0105242_10061550 | Ga0105242_100615502 | 223 |
| 81 | 3300025899 | Ga0207642_10000473 | Ga0207642_100004739 | 223 |
| 82 | 3300025934 | Ga0207686_10030532 | Ga0207686_100305324 | 223 |
| 83 | 3300025937 | Ga0207669_10000003 | Ga0207669_10000003255 | 223 |
| 84 | 3300046511 | Ga0495608_0000013 | Ga0495608_0000013_93265_93969 | 223 |
| 85 | 3300046675 | Ga0495657_0000003 | Ga0495657_0000003_144464_145168 | 223 |
| 86 | 3300047444 | Ga0495675_0000002 | Ga0495675_0000002_144464_145168 | 223 |
| 87 | 3300050510 | nmdc:mga06r32_35648_c1 | nmdc:mga06r32_35648_c1_3276_4130 | 223 |
| 88 | 3300050515 | nmdc:mga0a205_55222_c1 | nmdc:mga0a205_55222_c1_1282_2136 | 223 |
| 89 | 3300053084 | Ga0495595_0000007 | Ga0495595_0000007_93288_93992 | 223 |
| 90 | 3300053085 | Ga0495619_0000026 | Ga0495619_0000026_78572_79276 | 223 |
| 91 | 3300005367 | Ga0070667_100037746 | Ga0070667_1000377463 | 224 |
| 92 | 3300017792 | Ga0163161_10008446 | Ga0163161_100084465 | 224 |
| 93 | 3300048907 | Ga0496104_0000010 | Ga0496104_0000010_220383_221090 | 224 |
| 94 | 3300048908 | Ga0496105_0000005 | Ga0496105_0000005_220383_221090 | 224 |
| 95 | 3300048914 | Ga0496111_0024236 | Ga0496111_0024236_2057_2749 | 224 |
| 96 | 3300048923 | Ga0496120_0055981 | Ga0496120_0055981_20_727 | 224 |
| 97 | 3300049588 | Ga0501072_0283885 | Ga0501072_0283885_414_1103 | 224 |
| 98 | 3300053083 | Ga0495655_0000258 | Ga0495655_0000258_8154_8864 | 224 |
| 99 | 3300053129 | Ga0500628_000072 | Ga0500628_000072_1008_1718 | 224 |
| 100 | 3300001977 | JGI24746J21847_1000113 | JGI24746J21847_100011312 | 225 |
| 101 | 3300005337 | Ga0070682_100000026 | Ga0070682_100000026172 | 225 |
| 102 | 3300005366 | Ga0070659_100003678 | Ga0070659_1000036782 | 225 |
| 103 | 3300005539 | Ga0068853_100007596 | Ga0068853_1000075968 | 225 |
| 104 | 3300005577 | Ga0068857_100872954 | Ga0068857_1008729541 | 225 |
| 105 | 3300005578 | Ga0068854_100000082 | Ga0068854_10000008256 | 225 |
| 106 | 3300005614 | Ga0068856_100000136 | Ga0068856_10000013681 | 225 |
| 107 | 3300005614 | Ga0068856_100013363 | Ga0068856_1000133636 | 225 |
| 108 | 3300006038 | Ga0075365_10053996 | Ga0075365_100539961 | 225 |
| 109 | 3300009098 | Ga0105245_10038238 | Ga0105245_100382385 | 225 |
| 110 | 3300010375 | Ga0105239_10295715 | Ga0105239_102957152 | 225 |
| 111 | 3300010375 | Ga0105239_10366021 | Ga0105239_103660212 | 225 |
| 112 | 3300013102 | Ga0157371_10004888 | Ga0157371_100048884 | 225 |
| 113 | 3300013105 | Ga0157369_10001730 | Ga0157369_1000173023 | 225 |
| 114 | 3300013296 | Ga0157374_10101946 | Ga0157374_101019462 | 225 |
| 115 | 3300025927 | Ga0207687_10020955 | Ga0207687_100209555 | 225 |
| 116 | 3300025932 | Ga0207690_10002537 | Ga0207690_1000253714 | 225 |
| 117 | 3300025981 | Ga0207640_10000054 | Ga0207640_1000005431 | 225 |
| 118 | 3300026078 | Ga0207702_10000105 | Ga0207702_1000010593 | 225 |
| 119 | 3300026078 | Ga0207702_10001788 | Ga0207702_1000178812 | 225 |
| 120 | 3300041512 | Ga0451853_2761787 | Ga0451853_2761787_296_1009 | 225 |
| 121 | 3300041512 | Ga0451853_2804839 | Ga0451853_2804839_1224_1940 | 225 |
| 122 | 3300044842 | Ga0466957_0001268 | Ga0466957_0001268_1083_1793 | 225 |
| 123 | 3300046454 | Ga0495592_0171040 | Ga0495592_0171040_340_1035 | 225 |
| 124 | 3300046459 | Ga0495629_0050917 | Ga0495629_0050917_965_1681 | 225 |
| 125 | 3300046516 | Ga0495628_0003421 | Ga0495628_0003421_6657_7376 | 225 |
| 126 | 3300046529 | Ga0495652_0000018 | Ga0495652_0000018_87530_88225 | 225 |
| 127 | 3300046536 | Ga0495587_0000272 | Ga0495587_0000272_4873_5595 | 225 |
| 128 | 3300046536 | Ga0495587_0066517 | Ga0495587_0066517_889_1608 | 225 |
| 129 | 3300046689 | Ga0495613_0000027 | Ga0495613_0000027_137347_138057 | 225 |
| 130 | 3300047317 | Ga0495604_0000723 | Ga0495604_0000723_22120_22830 | 225 |
| 131 | 3300047317 | Ga0495604_0023180 | Ga0495604_0023180_133_843 | 225 |
| 132 | 3300047322 | Ga0495680_0103038 | Ga0495680_0103038_810_1553 | 225 |
| 133 | 3300047446 | Ga0495679_048025 | Ga0495679_048025_19_777 | 225 |
| 134 | 3300048088 | Ga0495602_0000034 | Ga0495602_0000034_79607_80317 | 225 |
| 135 | 3300048088 | Ga0495602_0009482 | Ga0495602_0009482_8359_9078 | 225 |
| 136 | 3300048905 | Ga0496102_0000749 | Ga0496102_0000749_22568_23281 | 225 |
| 137 | 3300048906 | Ga0496103_0003112 | Ga0496103_0003112_1067_1780 | 225 |
| 138 | 3300048912 | Ga0496109_0162586 | Ga0496109_0162586_782_1477 | 225 |
| 139 | 3300048913 | Ga0496110_0017911 | Ga0496110_0017911_1587_2348 | 225 |
| 140 | 3300048913 | Ga0496110_0127942 | Ga0496110_0127942_577_1272 | 225 |
| 141 | 3300048915 | Ga0496112_0000026 | Ga0496112_0000026_29314_30063 | 225 |
| 142 | 3300049578 | Ga0501042_0175217 | Ga0501042_0175217_304_1017 | 225 |
| 143 | 3300053077 | Ga0495601_0000017 | Ga0495601_0000017_8727_9437 | 225 |
| 144 | 3300053078 | Ga0495612_0008866 | Ga0495612_0008866_2788_3492 | 225 |
| 145 | 3300053083 | Ga0495655_0001219 | Ga0495655_0001219_1022_1732 | 225 |
| 146 | 3300053084 | Ga0495595_0007746 | Ga0495595_0007746_3000_3710 | 225 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rte-assembly2.cif.gz_B | dihydro-heme d1 dehydrogenase nirn in complex with dhe | 0.7761 | 132 | 214 |
| 1w2l-assembly1.cif.gz_A | cytochrome c domain of caa3 oxygen oxidoreductase | 0.7708 | 127 | 216 |
| 6rte-assembly1.cif.gz_A | dihydro-heme d1 dehydrogenase nirn in complex with dhe | 0.7483 | 132 | 214 |
| 4pw9-assembly1.cif.gz_B | crystal structure of the electron-transfer complex formed between a sulfite dehydrogenase and a c-type cytochrome from sinorhizobium meliloti | 0.721 | 132 | 218 |
| 1w2l-assembly1.cif.gz_A | cytochrome c domain of caa3 oxygen oxidoreductase | 0.7142 | 127 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pwaC00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7882 | 132 | 218 | 1.10.760.10 |
| 1w2lA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7708 | 127 | 216 | 1.10.760.10 |
| 4eifA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7282 | 132 | 218 | 1.10.760.10 |
| 1w2lA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7142 | 127 | 216 | 1.10.760.10 |
| 4pwaC00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7122 | 132 | 218 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538KAJ1-F1-model_v4 | Cytochrome c oxidase subunit 2 (EC 7.1.1.9) | 0.9876 | 133 | 217 |
GO:0004129
GO:0005507 GO:0005886 GO:0020037 GO:0042773 |
| AF-A0A7W0TSV4-F1-model_v4 | C-type cytochrome | 0.9852 | 132 | 214 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-H0E602-F1-model_v4 | Cytochrome c oxidase polypeptide II (EC 1.9.3.1) | 0.9816 | 132 | 217 |
GO:0009055
GO:0016020 GO:0016491 GO:0020037 GO:0046872 |
| AF-A0A537TV08-F1-model_v4 | C-type cytochrome | 0.9791 | 132 | 220 |
GO:0009055
GO:0016020 GO:0020037 GO:0046872 |
| AF-A0A7J9YTA2-F1-model_v4 | C-type cytochrome | 0.9382 | 132 | 223 |
GO:0009055
GO:0016020 GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar