F197207

General Info

Members Datasets Scaffolds Average Seq Length
146 112 146 227

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10053996|Ga0075365_100539961
Length 248
Sequence VSRRNFIPAGGSFAALAVAVAVVPLLSGCGVSTKGDFNRGKQLFAAQCSTCHALKDAGSTSTIGPNLDAAFSQARASGMDPETIAGVVKNQVENPRPAEETTGGANPSVSMPADLVTGEDLDDVASYLGTVAGNPEFKGPSLPDDPGALVFSQNNCAGCHTLEAAGASGTTGPDLDSAVPNDLKTASAVREAIVDPNKRIAPGFPPNVMPQTYGQEISSQDLNALVQFLLKCSGKGAQTAPCQPTSGK

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
88 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
89 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
90 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
107 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
108 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
109 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
110 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 13.7
Rhizosphere 82.19
Stem 0
Stem Tuber 0
Unclassified 2.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000113 3300001977 Bacteria 9482
2 Ga0070658_10081497 3300005327 Bacteria 2658
3 Ga0070683_100006417 3300005329 Bacteria 9863
4 Ga0070682_100000026 3300005337 Bacteria 191388
5 Ga0070661_100000004 3300005344 Bacteria 243876
6 Ga0070668_100023112 3300005347 Bacteria 4700
7 Ga0070675_100000050 3300005354 Bacteria 72016
8 Ga0070674_100000002 3300005356 Bacteria 271088
9 Ga0070688_100000010 3300005365 Bacteria 84103
10 Ga0070659_100003678 3300005366 Bacteria 10933
11 Ga0070667_100037746 3300005367 Bacteria 4050
12 Ga0070714_100014187 3300005435 Bacteria 6397
13 Ga0070711_100268238 3300005439 Bacteria 1346
14 Ga0068867_100000078 3300005459 Bacteria 59729
15 Ga0070685_10000010 3300005466 Bacteria 146946
16 Ga0070684_100535636 3300005535 Bacteria 1086
17 Ga0068853_100007596 3300005539 Bacteria 8682
18 Ga0070672_100000031 3300005543 Bacteria 62241
19 Ga0070664_100024741 3300005564 Bacteria 4971
20 Ga0068857_100872954 3300005577 Bacteria 862
21 Ga0068854_100000082 3300005578 Bacteria 68340
22 Ga0068856_100000136 3300005614 Bacteria 74026
23 Ga0068856_100013363 3300005614 Bacteria 7950
24 Ga0070702_100054974 3300005615 Bacteria 2293
25 Ga0068852_100000994 3300005616 Bacteria 18720
26 Ga0068866_10000206 3300005718 Bacteria 27716
27 Ga0068851_10001071 3300005834 Bacteria 11849
28 Ga0081455_10004942 3300005937 Bacteria 14737
29 Ga0081455_10073005 3300005937 Bacteria 2838
30 Ga0081538_10170516 3300005981 Bacteria 950
31 Ga0081540_1001098 3300005983 Bacteria 23963
32 Ga0075365_10053996 3300006038 Bacteria 2663
33 Ga0075433_10020200 3300006852 Bacteria 5565
34 Ga0068865_100001495 3300006881 Bacteria 13634
35 Ga0105245_10038238 3300009098 Bacteria 4270
36 Ga0105245_10104770 3300009098 Bacteria 2623
37 Ga0105241_10116429 3300009174 Bacteria 2146
38 Ga0105242_10000063 3300009176 Bacteria 74721
39 Ga0105242_10061550 3300009176 Bacteria 3087
40 Ga0105239_10295715 3300010375 Bacteria 1823
41 Ga0105239_10366021 3300010375 Bacteria 1629
42 Ga0157371_10004888 3300013102 Bacteria 11513
43 Ga0157370_10262774 3300013104 Bacteria 1595
44 Ga0157369_10001730 3300013105 Bacteria 26528
45 Ga0157374_10101946 3300013296 Bacteria 2752
46 Ga0157378_10016178 3300013297 Bacteria 6532
47 Ga0157372_10000146 3300013307 Bacteria 77952
48 Ga0163161_10008446 3300017792 Bacteria 7130
49 Ga0206356_10666627 3300020070 Bacteria 2422
50 Ga0207656_10001283 3300025321 Bacteria 8251
51 Ga0207642_10000473 3300025899 Bacteria 12319
52 Ga0207705_10162574 3300025909 Bacteria 1678
53 Ga0207649_10000003 3300025920 Bacteria 388908
54 Ga0207650_10030751 3300025925 Bacteria 3871
55 Ga0207659_10000055 3300025926 Bacteria 74252
56 Ga0207687_10020955 3300025927 Bacteria 4339
57 Ga0207664_10015535 3300025929 Bacteria 5529
58 Ga0207690_10002537 3300025932 Bacteria 11031
59 Ga0207686_10000230 3300025934 Bacteria 42566
60 Ga0207686_10030532 3300025934 Bacteria 3192
61 Ga0207669_10000003 3300025937 Bacteria 252239
62 Ga0207704_10000104 3300025938 Bacteria 46614
63 Ga0207691_10000178 3300025940 Bacteria 60110
64 Ga0207661_10002281 3300025944 Bacteria 13216
65 Ga0207679_10018802 3300025945 Bacteria 4635
66 Ga0207640_10000054 3300025981 Bacteria 95136
67 Ga0207702_10000105 3300026078 Bacteria 97835
68 Ga0207702_10001788 3300026078 Bacteria 21174
69 Ga0207698_10000015 3300026142 Bacteria 207368
70 Ga0265319_1000010 3300028563 Bacteria 188773
71 Ga0265338_10000287 3300028800 Bacteria 90818
72 Ga0265325_10028601 3300031241 Bacteria 3003
73 Ga0395899_0227118 3300037312 Bacteria 1291
74 Ga0395900_0106096 3300037418 Bacteria 2886
75 Ga0395900_0119968 3300037418 Bacteria 2699
76 Ga0395900_0164100 3300037418 Bacteria 2265
77 Ga0395900_0185352 3300037418 Bacteria 2113
78 Ga0395900_0568550 3300037418 Bacteria 1077
79 Ga0395898_0039160 3300037466 Bacteria 4693
80 Ga0395898_0167573 3300037466 Bacteria 2100
81 Ga0395898_0299959 3300037466 Bacteria 1533
82 Ga0395905_0243357 3300037471 Bacteria 1681
83 Ga0395901_0259393 3300038443 Bacteria 1809
84 Ga0395901_0440394 3300038443 Bacteria 1334
85 Ga0451853_1257484 3300041512 Bacteria 3450
86 Ga0451853_2761787 3300041512 Bacteria 1777
87 Ga0451853_2804839 3300041512 Bacteria 2000
88 Ga0466957_0001268 3300044842 Bacteria 13149
89 Ga0466967_0000002 3300045976 Bacteria 219994
90 Ga0495592_0171040 3300046454 Bacteria 1488
91 Ga0495629_0050917 3300046459 Bacteria 2899
92 Ga0495662_0002052 3300046476 Bacteria 10100
93 Ga0495606_0000017 3300046507 Bacteria 284549
94 Ga0495608_0000013 3300046511 Bacteria 228481
95 Ga0495628_0003421 3300046516 Bacteria 14207
96 Ga0495628_0092510 3300046516 Bacteria 2339
97 Ga0495630_0000032 3300046517 Bacteria 134425
98 Ga0495652_0000018 3300046529 Bacteria 201634
99 Ga0495587_0000272 3300046536 Bacteria 36939
100 Ga0495587_0066517 3300046536 Bacteria 2102
101 Ga0495657_0000003 3300046675 Bacteria 279680
102 Ga0495613_0000027 3300046689 Bacteria 146674
103 Ga0495624_0000123 3300046690 Bacteria 54291
104 Ga0495604_0000723 3300047317 Bacteria 27948
105 Ga0495604_0023180 3300047317 Bacteria 4954
106 Ga0495680_0103038 3300047322 Bacteria 2124
107 Ga0495675_0000002 3300047444 Bacteria 216469
108 Ga0495679_048025 3300047446 Bacteria 1292
109 Ga0495602_0000034 3300048088 Bacteria 140722
110 Ga0495602_0009482 3300048088 Bacteria 10121
111 Ga0496102_0000749 3300048905 Bacteria 31723
112 Ga0496103_0003112 3300048906 Bacteria 10202
113 Ga0496104_0000010 3300048907 Bacteria 475255
114 Ga0496104_0214342 3300048907 Bacteria 1837
115 Ga0496105_0000005 3300048908 Bacteria 475797
116 Ga0496108_0000005 3300048911 Bacteria 535059
117 Ga0496108_0039188 3300048911 Bacteria 3950
118 Ga0496109_0000002 3300048912 Bacteria 443393
119 Ga0496109_0000221 3300048912 Bacteria 56054
120 Ga0496109_0162586 3300048912 Bacteria 2092
121 Ga0496110_0000052 3300048913 Bacteria 58549
122 Ga0496110_0017911 3300048913 Bacteria 5931
123 Ga0496110_0116709 3300048913 Bacteria 2403
124 Ga0496110_0127942 3300048913 Bacteria 2292
125 Ga0496111_0005704 3300048914 Bacteria 8021
126 Ga0496111_0021345 3300048914 Bacteria 4521
127 Ga0496111_0024236 3300048914 Bacteria 4270
128 Ga0496112_0000026 3300048915 Bacteria 144758
129 Ga0496112_0021401 3300048915 Bacteria 6150
130 Ga0496113_0000005 3300048916 Bacteria 105956
131 Ga0496120_0055981 3300048923 Bacteria 2228
132 Ga0501042_0175217 3300049578 Bacteria 1547
133 Ga0501070_0455839 3300049586 Bacteria 1031
134 Ga0501072_0283885 3300049588 Bacteria 1317
135 nmdc:mga06r32_35648_c1 3300050510 Bacteria 4695
136 nmdc:mga0a205_55222_c1 3300050515 Bacteria 3836
137 Ga0495601_0000017 3300053077 Bacteria 204209
138 Ga0495612_0008866 3300053078 Bacteria 4074
139 Ga0495612_0010356 3300053078 Bacteria 3772
140 Ga0495655_0000258 3300053083 Bacteria 9877
141 Ga0495655_0001219 3300053083 Bacteria 3972
142 Ga0495595_0000007 3300053084 Bacteria 228504
143 Ga0495595_0007746 3300053084 Bacteria 4398
144 Ga0495619_0000026 3300053085 Bacteria 167387
145 Ga0495619_0000088 3300053085 Bacteria 69615
146 Ga0500628_000072 3300053129 Bacteria 26251

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006881 Ga0068865_100001495 Ga0068865_10000149511 187
2 3300025938 Ga0207704_10000104 Ga0207704_1000010418 187
3 3300013104 Ga0157370_10262774 Ga0157370_102627742 193
4 3300005834 Ga0068851_10001071 Ga0068851_1000107110 194
5 3300025321 Ga0207656_10001283 Ga0207656_100012832 194
6 3300046507 Ga0495606_0000017 Ga0495606_0000017_55572_56267 194
7 3300028563 Ga0265319_1000010 Ga0265319_100001046 197
8 3300028800 Ga0265338_10000287 Ga0265338_1000028763 197
9 3300031241 Ga0265325_10028601 Ga0265325_100286015 197
10 3300013307 Ga0157372_10000146 Ga0157372_100001469 198
11 3300048913 Ga0496110_0000052 Ga0496110_0000052_18676_19389 198
12 3300048914 Ga0496111_0005704 Ga0496111_0005704_1287_2000 198
13 3300009174 Ga0105241_10116429 Ga0105241_101164292 200
14 3300005535 Ga0070684_100535636 Ga0070684_1005356361 203
15 3300005564 Ga0070664_100024741 Ga0070664_1000247412 203
16 3300025945 Ga0207679_10018802 Ga0207679_100188027 203
17 3300005365 Ga0070688_100000010 Ga0070688_10000001012 204
18 3300005466 Ga0070685_10000010 Ga0070685_10000010115 204
19 3300046476 Ga0495662_0002052 Ga0495662_0002052_3983_4696 205
20 3300049586 Ga0501070_0455839 Ga0501070_0455839_264_956 205
21 3300005937 Ga0081455_10073005 Ga0081455_100730052 206
22 3300053078 Ga0495612_0010356 Ga0495612_0010356_2624_3316 206
23 3300045976 Ga0466967_0000002 Ga0466967_0000002_30285_30995 208
24 3300037418 Ga0395900_0119968 Ga0395900_0119968_1158_1922 210
25 3300038443 Ga0395901_0440394 Ga0395901_0440394_504_1268 210
26 3300048915 Ga0496112_0021401 Ga0496112_0021401_1057_1767 210
27 3300048916 Ga0496113_0000005 Ga0496113_0000005_89974_90684 210
28 3300005344 Ga0070661_100000004 Ga0070661_100000004234 211
29 3300005354 Ga0070675_100000050 Ga0070675_10000005036 211
30 3300013297 Ga0157378_10016178 Ga0157378_100161785 211
31 3300025920 Ga0207649_10000003 Ga0207649_1000000325 211
32 3300025926 Ga0207659_10000055 Ga0207659_1000005538 211
33 3300005435 Ga0070714_100014187 Ga0070714_1000141874 212
34 3300005981 Ga0081538_10170516 Ga0081538_101705161 212
35 3300005983 Ga0081540_1001098 Ga0081540_10010985 212
36 3300025929 Ga0207664_10015535 Ga0207664_100155357 212
37 3300037312 Ga0395899_0227118 Ga0395899_0227118_148_891 212
38 3300037418 Ga0395900_0185352 Ga0395900_0185352_1049_1792 212
39 3300037466 Ga0395898_0167573 Ga0395898_0167573_427_1170 212
40 3300037466 Ga0395898_0299959 Ga0395898_0299959_135_800 212
41 3300037471 Ga0395905_0243357 Ga0395905_0243357_804_1547 212
42 3300038443 Ga0395901_0259393 Ga0395901_0259393_68_811 212
43 3300041512 Ga0451853_1257484 Ga0451853_1257484_1981_2745 212
44 3300005616 Ga0068852_100000994 Ga0068852_1000009942 213
45 3300026142 Ga0207698_10000015 Ga0207698_10000015102 213
46 3300037418 Ga0395900_0164100 Ga0395900_0164100_1312_2073 214
47 3300037466 Ga0395898_0039160 Ga0395898_0039160_709_1470 214
48 3300005615 Ga0070702_100054974 Ga0070702_1000549742 215
49 3300048911 Ga0496108_0000005 Ga0496108_0000005_433225_433935 215
50 3300048912 Ga0496109_0000002 Ga0496109_0000002_101157_101867 215
51 3300048911 Ga0496108_0039188 Ga0496108_0039188_2923_3624 216
52 3300048912 Ga0496109_0000221 Ga0496109_0000221_45938_46639 216
53 3300005329 Ga0070683_100006417 Ga0070683_1000064175 217
54 3300005439 Ga0070711_100268238 Ga0070711_1002682381 217
55 3300025925 Ga0207650_10030751 Ga0207650_100307515 217
56 3300025944 Ga0207661_10002281 Ga0207661_100022818 217
57 3300048913 Ga0496110_0116709 Ga0496110_0116709_254_964 217
58 3300048914 Ga0496111_0021345 Ga0496111_0021345_2755_3465 217
59 3300005543 Ga0070672_100000031 Ga0070672_10000003161 219
60 3300009176 Ga0105242_10000063 Ga0105242_1000006345 219
61 3300020070 Ga0206356_10666627 Ga0206356_106666272 219
62 3300025934 Ga0207686_10000230 Ga0207686_1000023045 219
63 3300025940 Ga0207691_10000178 Ga0207691_1000017824 219
64 3300037418 Ga0395900_0106096 Ga0395900_0106096_1463_2182 219
65 3300037418 Ga0395900_0568550 Ga0395900_0568550_198_887 219
66 3300048907 Ga0496104_0214342 Ga0496104_0214342_888_1598 219
67 3300005327 Ga0070658_10081497 Ga0070658_100814972 220
68 3300009098 Ga0105245_10104770 Ga0105245_101047703 220
69 3300025909 Ga0207705_10162574 Ga0207705_101625742 220
70 3300046517 Ga0495630_0000032 Ga0495630_0000032_73045_73740 220
71 3300053085 Ga0495619_0000088 Ga0495619_0000088_48776_49489 220
72 3300005347 Ga0070668_100023112 Ga0070668_1000231126 222
73 3300005459 Ga0068867_100000078 Ga0068867_10000007837 222
74 3300005937 Ga0081455_10004942 Ga0081455_100049425 222
75 3300006852 Ga0075433_10020200 Ga0075433_100202007 222
76 3300046516 Ga0495628_0092510 Ga0495628_0092510_789_1502 222
77 3300046690 Ga0495624_0000123 Ga0495624_0000123_8984_9727 222
78 3300005356 Ga0070674_100000002 Ga0070674_10000000240 223
79 3300005718 Ga0068866_10000206 Ga0068866_1000020618 223
80 3300009176 Ga0105242_10061550 Ga0105242_100615502 223
81 3300025899 Ga0207642_10000473 Ga0207642_100004739 223
82 3300025934 Ga0207686_10030532 Ga0207686_100305324 223
83 3300025937 Ga0207669_10000003 Ga0207669_10000003255 223
84 3300046511 Ga0495608_0000013 Ga0495608_0000013_93265_93969 223
85 3300046675 Ga0495657_0000003 Ga0495657_0000003_144464_145168 223
86 3300047444 Ga0495675_0000002 Ga0495675_0000002_144464_145168 223
87 3300050510 nmdc:mga06r32_35648_c1 nmdc:mga06r32_35648_c1_3276_4130 223
88 3300050515 nmdc:mga0a205_55222_c1 nmdc:mga0a205_55222_c1_1282_2136 223
89 3300053084 Ga0495595_0000007 Ga0495595_0000007_93288_93992 223
90 3300053085 Ga0495619_0000026 Ga0495619_0000026_78572_79276 223
91 3300005367 Ga0070667_100037746 Ga0070667_1000377463 224
92 3300017792 Ga0163161_10008446 Ga0163161_100084465 224
93 3300048907 Ga0496104_0000010 Ga0496104_0000010_220383_221090 224
94 3300048908 Ga0496105_0000005 Ga0496105_0000005_220383_221090 224
95 3300048914 Ga0496111_0024236 Ga0496111_0024236_2057_2749 224
96 3300048923 Ga0496120_0055981 Ga0496120_0055981_20_727 224
97 3300049588 Ga0501072_0283885 Ga0501072_0283885_414_1103 224
98 3300053083 Ga0495655_0000258 Ga0495655_0000258_8154_8864 224
99 3300053129 Ga0500628_000072 Ga0500628_000072_1008_1718 224
100 3300001977 JGI24746J21847_1000113 JGI24746J21847_100011312 225
101 3300005337 Ga0070682_100000026 Ga0070682_100000026172 225
102 3300005366 Ga0070659_100003678 Ga0070659_1000036782 225
103 3300005539 Ga0068853_100007596 Ga0068853_1000075968 225
104 3300005577 Ga0068857_100872954 Ga0068857_1008729541 225
105 3300005578 Ga0068854_100000082 Ga0068854_10000008256 225
106 3300005614 Ga0068856_100000136 Ga0068856_10000013681 225
107 3300005614 Ga0068856_100013363 Ga0068856_1000133636 225
108 3300006038 Ga0075365_10053996 Ga0075365_100539961 225
109 3300009098 Ga0105245_10038238 Ga0105245_100382385 225
110 3300010375 Ga0105239_10295715 Ga0105239_102957152 225
111 3300010375 Ga0105239_10366021 Ga0105239_103660212 225
112 3300013102 Ga0157371_10004888 Ga0157371_100048884 225
113 3300013105 Ga0157369_10001730 Ga0157369_1000173023 225
114 3300013296 Ga0157374_10101946 Ga0157374_101019462 225
115 3300025927 Ga0207687_10020955 Ga0207687_100209555 225
116 3300025932 Ga0207690_10002537 Ga0207690_1000253714 225
117 3300025981 Ga0207640_10000054 Ga0207640_1000005431 225
118 3300026078 Ga0207702_10000105 Ga0207702_1000010593 225
119 3300026078 Ga0207702_10001788 Ga0207702_1000178812 225
120 3300041512 Ga0451853_2761787 Ga0451853_2761787_296_1009 225
121 3300041512 Ga0451853_2804839 Ga0451853_2804839_1224_1940 225
122 3300044842 Ga0466957_0001268 Ga0466957_0001268_1083_1793 225
123 3300046454 Ga0495592_0171040 Ga0495592_0171040_340_1035 225
124 3300046459 Ga0495629_0050917 Ga0495629_0050917_965_1681 225
125 3300046516 Ga0495628_0003421 Ga0495628_0003421_6657_7376 225
126 3300046529 Ga0495652_0000018 Ga0495652_0000018_87530_88225 225
127 3300046536 Ga0495587_0000272 Ga0495587_0000272_4873_5595 225
128 3300046536 Ga0495587_0066517 Ga0495587_0066517_889_1608 225
129 3300046689 Ga0495613_0000027 Ga0495613_0000027_137347_138057 225
130 3300047317 Ga0495604_0000723 Ga0495604_0000723_22120_22830 225
131 3300047317 Ga0495604_0023180 Ga0495604_0023180_133_843 225
132 3300047322 Ga0495680_0103038 Ga0495680_0103038_810_1553 225
133 3300047446 Ga0495679_048025 Ga0495679_048025_19_777 225
134 3300048088 Ga0495602_0000034 Ga0495602_0000034_79607_80317 225
135 3300048088 Ga0495602_0009482 Ga0495602_0009482_8359_9078 225
136 3300048905 Ga0496102_0000749 Ga0496102_0000749_22568_23281 225
137 3300048906 Ga0496103_0003112 Ga0496103_0003112_1067_1780 225
138 3300048912 Ga0496109_0162586 Ga0496109_0162586_782_1477 225
139 3300048913 Ga0496110_0017911 Ga0496110_0017911_1587_2348 225
140 3300048913 Ga0496110_0127942 Ga0496110_0127942_577_1272 225
141 3300048915 Ga0496112_0000026 Ga0496112_0000026_29314_30063 225
142 3300049578 Ga0501042_0175217 Ga0501042_0175217_304_1017 225
143 3300053077 Ga0495601_0000017 Ga0495601_0000017_8727_9437 225
144 3300053078 Ga0495612_0008866 Ga0495612_0008866_2788_3492 225
145 3300053083 Ga0495655_0001219 Ga0495655_0001219_1022_1732 225
146 3300053084 Ga0495595_0007746 Ga0495595_0007746_3000_3710 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

145

233

0.83

PF00034

Cytochrom_C

Cytochrome c

37

132

0.76

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

142

229

0.7

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

35

128

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rte-assembly2.cif.gz_B dihydro-heme d1 dehydrogenase nirn in complex with dhe 0.7761 132 214
1w2l-assembly1.cif.gz_A cytochrome c domain of caa3 oxygen oxidoreductase 0.7708 127 216
6rte-assembly1.cif.gz_A dihydro-heme d1 dehydrogenase nirn in complex with dhe 0.7483 132 214
4pw9-assembly1.cif.gz_B crystal structure of the electron-transfer complex formed between a sulfite dehydrogenase and a c-type cytochrome from sinorhizobium meliloti 0.721 132 218
1w2l-assembly1.cif.gz_A cytochrome c domain of caa3 oxygen oxidoreductase 0.7142 127 216
ID Description Score Start End Superfamily
4pwaC00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7882 132 218 1.10.760.10
1w2lA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7708 127 216 1.10.760.10
4eifA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7282 132 218 1.10.760.10
1w2lA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7142 127 216 1.10.760.10
4pwaC00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7122 132 218 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A538KAJ1-F1-model_v4 Cytochrome c oxidase subunit 2 (EC 7.1.1.9) 0.9876 133 217 GO:0004129
GO:0005507
GO:0005886
GO:0020037
GO:0042773
AF-A0A7W0TSV4-F1-model_v4 C-type cytochrome 0.9852 132 214 GO:0009055
GO:0020037
GO:0046872
AF-H0E602-F1-model_v4 Cytochrome c oxidase polypeptide II (EC 1.9.3.1) 0.9816 132 217 GO:0009055
GO:0016020
GO:0016491
GO:0020037
GO:0046872
AF-A0A537TV08-F1-model_v4 C-type cytochrome 0.9791 132 220 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A7J9YTA2-F1-model_v4 C-type cytochrome 0.9382 132 223 GO:0009055
GO:0016020
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
82.67 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map