F197942

General Info

Members Datasets Scaffolds Average Seq Length
146 106 292 95

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10019758|Ga0265324_100197583
Length 110
Sequence MSGDAGPGVGATFSVTLPSGATWTPTFVQSIDEAKCIGCGRCFRVCPRGVLELVGLDDEGERIALDPDGDEEEEYEKKVMTIAHRELCIGCTACSKICPKKCYTHAAASA

Samples

Sample ID Description Type Environment
1 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
12 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
13 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
17 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
18 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
22 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
23 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
24 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
25 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
26 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
27 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
28 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
29 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
30 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
31 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
32 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
33 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
34 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
35 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
36 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
37 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
38 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
39 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
40 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
41 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
42 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
43 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
44 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
45 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
46 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
47 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
48 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
49 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
50 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
51 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
52 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
53 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
54 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
55 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
56 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
57 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
58 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
59 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
60 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
62 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
63 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
64 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
65 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
66 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
67 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
68 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
69 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
70 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
71 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
72 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
73 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
74 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
75 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
76 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
77 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
78 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
79 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
80 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
81 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
82 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
83 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
84 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
85 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
86 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
87 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
88 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
89 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
90 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
91 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
92 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
93 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
94 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
95 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
96 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
97 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
98 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
99 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
100 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
101 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
102 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
103 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
104 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
105 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
106 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.97
Metatranscriptomes 0
Isolates 26.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 8.22
Rhizoplane 1.37
Rhizosphere 67.81
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265324_10019758 3300029957 Bacteria 2425
2 JGI25157J39369_1019042 3300002741 Bacteria 825
3 rootH1_10003087 3300003316 Bacteria 52943
4 rootL2_10006881 3300003322 Bacteria 64959
5 rootL2_10021865 3300003322 Bacteria 3099
6 Ga0065704_10533116 3300005289 Bacteria 646
7 Ga0070667_100694648 3300005367 Bacteria 941
8 Ga0068867_100000066 3300005459 Bacteria 63559
9 Ga0070699_101321498 3300005518 Bacteria 661
10 Ga0068860_100107419 3300005843 Bacteria 2667
11 Ga0075367_10260360 3300006178 Bacteria 1089
12 Ga0075369_10337374 3300006186 Bacteria 706
13 Ga0075366_10076468 3300006195 Bacteria 1998
14 Ga0075430_100046873 3300006846 Bacteria 3650
15 Ga0075430_100445583 3300006846 Bacteria 1069
16 Ga0075429_100000138 3300006880 Bacteria 43993
17 Ga0075429_100690541 3300006880 Bacteria 894
18 Ga0105243_10003572 3300009148 Bacteria 12555
19 Ga0157377_10000035 3300014745 Bacteria 116860
20 Ga0209026_1001119 3300025250 Bacteria 12693
21 Ga0207709_10000858 3300025935 Bacteria 23259
22 Ga0207648_10000040 3300026089 Bacteria 116539
23 Ga0268264_10057976 3300028381 Bacteria 3241
24 Ga0265336_10000013 3300028666 Bacteria 252156
25 Ga0307515_10369804 3300028794 Bacteria 1071
26 Ga0265324_10006254 3300029957 Bacteria 5000
27 Ga0265324_10216075 3300029957 Bacteria 651
28 Ga0265328_10000001 3300031239 Bacteria 371500
29 Ga0265328_10003243 3300031239 Bacteria 7212
30 Ga0265328_10055022 3300031239 Bacteria 1460
31 Ga0265331_10000050 3300031250 Bacteria 181286
32 Ga0265331_10030370 3300031250 Bacteria 2690
33 Ga0265331_10081321 3300031250 Unclassified 1504
34 Ga0265331_10108074 3300031250 Bacteria 1277
35 Ga0265327_10000109 3300031251 Bacteria 181275
36 Ga0265327_10000283 3300031251 Bacteria 100296
37 Ga0265327_10000681 3300031251 Bacteria 54587
38 Ga0265327_10001132 3300031251 Bacteria 36609
39 Ga0265327_10005810 3300031251 Bacteria 10135
40 Ga0265327_10025567 3300031251 Bacteria 3439
41 Ga0265327_10030331 3300031251 Bacteria 3059
42 Ga0265327_10215030 3300031251 Bacteria 866
43 Ga0265316_10281568 3300031344 Bacteria 1215
44 Ga0265316_10458148 3300031344 Bacteria 914
45 Ga0265316_10919372 3300031344 Bacteria 611
46 Ga0307514_10002630 3300031649 Bacteria 18347
47 Ga0307516_10176458 3300031730 Bacteria 1873
48 Ga0307406_11107298 3300031901 Bacteria 684
49 Ga0307412_10035528 3300031911 Bacteria 3185
50 Ga0307416_100147453 3300032002 Bacteria 2151
51 Ga0316583_10057038 3300032133 Bacteria 1372
52 Ga0373952_0142943 3300035092 Bacteria 666
53 Ga0373955_0555154 3300035172 Bacteria 703
54 Ga0373931_0228198 3300035691 Bacteria 1124
55 Ga0395898_0438750 3300037466 Bacteria 1244
56 Ga0395905_0001078 3300037471 Bacteria 34323
57 Ga0395905_0004033 3300037471 Bacteria 15413
58 Ga0395905_0099813 3300037471 Bacteria 2726
59 Ga0395905_0815271 3300037471 Bacteria 836
60 Ga0395901_0235064 3300038443 Bacteria 1913
61 Ga0439459_0091413 3300042438 Bacteria 732
62 Ga0451577_0000166 3300042876 Bacteria 145166
63 Ga0451577_0009283 3300042876 Bacteria 9480
64 Ga0451577_0009504 3300042876 Bacteria 9357
65 Ga0451577_1998277 3300042876 Bacteria 507
66 Ga0453683_0009961 3300044673 Bacteria 6322
67 Ga0453684_0000187 3300044712 Bacteria 272378
68 Ga0453684_0010999 3300044712 Bacteria 15294
69 Ga0453684_0036105 3300044712 Bacteria 6817
70 Ga0453684_0103701 3300044712 Bacteria 3474
71 Ga0453684_0144631 3300044712 Bacteria 2834
72 Ga0453684_0155132 3300044712 Bacteria 2716
73 Ga0453684_0223552 3300044712 Bacteria 2179
74 Ga0453684_0425584 3300044712 Bacteria 1482
75 Ga0453684_0431681 3300044712 Bacteria 1470
76 Ga0451576_0001582 3300045051 Bacteria 38269
77 Ga0451576_0027118 3300045051 Bacteria 6156
78 Ga0451576_0042005 3300045051 Bacteria 4828
79 Ga0451576_0168723 3300045051 Bacteria 2284
80 Ga0495590_0011237 3300046457 Bacteria 3352
81 Ga0495616_0308613 3300046513 Bacteria 667
82 Ga0495654_0211691 3300046530 Bacteria 824
83 Ga0495660_0026487 3300046810 Bacteria 3287
84 Ga0496112_1457174 3300048915 Bacteria 599
85 Ga0496113_0274436 3300048916 Bacteria 1348
86 Ga0496121_0024854 3300048924 Bacteria 5712
87 Ga0496122_0000531 3300048925 Bacteria 79144
88 Ga0496123_0000581 3300048926 Bacteria 62266
89 Ga0496124_0005099 3300048927 Bacteria 14957
90 Ga0501290_052497 3300049513 Bacteria 638
91 Ga0501295_203266 3300049518 Bacteria 500
92 Ga0501298_023436 3300049521 Bacteria 1170
93 Ga0501300_006287 3300049523 Bacteria 1750
94 Ga0501301_001692 3300049524 Bacteria 1415
95 Ga0501303_002524 3300049526 Bacteria 1418
96 Ga0501047_0127947 3300049581 Bacteria 2420
97 Ga0501206_003850 3300049653 Bacteria 1905
98 Ga0501262_012465 3300049759 Bacteria 1087
99 Ga0501265_004825 3300049762 Bacteria 1546
100 Ga0501280_000471 3300049776 Bacteria 9578
101 Ga0501282_001238 3300049778 Bacteria 2868
102 nmdc:mga0k408_71513_c1 3300050493 Bacteria 2025
103 nmdc:mga09592_192441_c1 3300050508 Bacteria 1765
104 nmdc:mga09592_4527_c1 3300050508 Bacteria 11245
105 nmdc:mga0qj67_155016_c1 3300050509 Bacteria 1859
106 nmdc:mga0qj67_254758_c1 3300050509 Bacteria 1424
107 nmdc:mga0qj67_826691_c1 3300050509 Bacteria 732
108 Ga0500618_000884 3300053125 Bacteria 15896
109 2501071294 2501025501 Bacteria 7768574
110 2501079515 2501025502 Bacteria 9641094
111 2501414179 2501025504 Bacteria 8008976
112 2510246321 2510065045 Bacteria 7761063
113 2510249613 2510065045 Bacteria 7761063
114 2511093870 2510917013 Bacteria 9951648
115 2511094568 2510917014 Bacteria 8296963
116 2511104272 2510917015 Bacteria 7950052
117 2512348696 2512047030 Bacteria 9031815
118 2514055858 2513237166 Bacteria 10373764
119 2515685639 2515154122 Bacteria 8609520
120 2527080456 2526164713 Bacteria 6780608
121 2553007359 2551306416 Bacteria 6152985
122 2585291708 2582581311 Bacteria 6763856
123 2600813536 2600255067 Bacteria 6795583
124 2719641986 2718217991 Bacteria 7829542
125 2753569228 2751185846 Bacteria 7242164
126 2792841354 2791355137 Bacteria 9654227
127 2817262693 2816332253 Bacteria 6764532
128 2817276235 2816332256 Bacteria 6891714
129 2817453678 2816332286 Bacteria 6853759
130 2819613992 2818991449 Bacteria 5518009
131 2856291669 2856287931 Bacteria 7223934
132 2857361610 2857357740 Bacteria 9937880
133 2885272277 2885270888 Bacteria 9831543
134 2900643140 2900634093 Bacteria 10263517
135 2902687556 2902682994 Bacteria 8951596
136 2904617802 2904615490 Bacteria 10047340
137 2921647999 2921643360 Bacteria 11448031
138 2923511719 2923510766 Bacteria 5926163
139 2928117748 2928115317 Bacteria 6477646
140 642599263 642555112 Bacteria 8676562
141 644749835 644736347 Bacteria 6476522
142 8020809666 8020807995 Bacteria 6801506
143 8040168552 8040167225 Bacteria 6542727
144 8040178343 8040173305 Bacteria 6827067
145 8055268501 8055266321 Bacteria 7999742
146 8055308764 8055301274 Bacteria 8587385
147 Ga0265324_10019758
148 JGI25157J39369_1019042
149 rootH1_10003087
150 rootL2_10006881
151 rootL2_10021865
152 Ga0065704_10533116
153 Ga0070667_100694648
154 Ga0068867_100000066
155 Ga0070699_101321498
156 Ga0068860_100107419
157 Ga0075367_10260360
158 Ga0075369_10337374
159 Ga0075366_10076468
160 Ga0075430_100046873
161 Ga0075430_100445583
162 Ga0075429_100000138
163 Ga0075429_100690541
164 Ga0105243_10003572
165 Ga0157377_10000035
166 Ga0209026_1001119
167 Ga0207709_10000858
168 Ga0207648_10000040
169 Ga0268264_10057976
170 Ga0265336_10000013
171 Ga0307515_10369804
172 Ga0265324_10006254
173 Ga0265324_10216075
174 Ga0265328_10000001
175 Ga0265328_10003243
176 Ga0265328_10055022
177 Ga0265331_10000050
178 Ga0265331_10030370
179 Ga0265331_10081321
180 Ga0265331_10108074
181 Ga0265327_10000109
182 Ga0265327_10000283
183 Ga0265327_10000681
184 Ga0265327_10001132
185 Ga0265327_10005810
186 Ga0265327_10025567
187 Ga0265327_10030331
188 Ga0265327_10215030
189 Ga0265316_10281568
190 Ga0265316_10458148
191 Ga0265316_10919372
192 Ga0307514_10002630
193 Ga0307516_10176458
194 Ga0307406_11107298
195 Ga0307412_10035528
196 Ga0307416_100147453
197 Ga0316583_10057038
198 Ga0373952_0142943
199 Ga0373955_0555154
200 Ga0373931_0228198
201 Ga0395898_0438750
202 Ga0395905_0001078
203 Ga0395905_0004033
204 Ga0395905_0099813
205 Ga0395905_0815271
206 Ga0395901_0235064
207 Ga0439459_0091413
208 Ga0451577_0000166
209 Ga0451577_0009283
210 Ga0451577_0009504
211 Ga0451577_1998277
212 Ga0453683_0009961
213 Ga0453684_0000187
214 Ga0453684_0010999
215 Ga0453684_0036105
216 Ga0453684_0103701
217 Ga0453684_0144631
218 Ga0453684_0155132
219 Ga0453684_0223552
220 Ga0453684_0425584
221 Ga0453684_0431681
222 Ga0451576_0001582
223 Ga0451576_0027118
224 Ga0451576_0042005
225 Ga0451576_0168723
226 Ga0495590_0011237
227 Ga0495616_0308613
228 Ga0495654_0211691
229 Ga0495660_0026487
230 Ga0496112_1457174
231 Ga0496113_0274436
232 Ga0496121_0024854
233 Ga0496122_0000531
234 Ga0496123_0000581
235 Ga0496124_0005099
236 Ga0501290_052497
237 Ga0501295_203266
238 Ga0501298_023436
239 Ga0501300_006287
240 Ga0501301_001692
241 Ga0501303_002524
242 Ga0501047_0127947
243 Ga0501206_003850
244 Ga0501262_012465
245 Ga0501265_004825
246 Ga0501280_000471
247 Ga0501282_001238
248 nmdc:mga0k408_71513_c1
249 nmdc:mga09592_192441_c1
250 nmdc:mga09592_4527_c1
251 nmdc:mga0qj67_155016_c1
252 nmdc:mga0qj67_254758_c1
253 nmdc:mga0qj67_826691_c1
254 Ga0500618_000884
255 2501071294
256 2501079515
257 2501414179
258 2510246321
259 2510249613
260 2511093870
261 2511094568
262 2511104272
263 2512348696
264 2514055858
265 2515685639
266 2527080456
267 2553007359
268 2585291708
269 2600813536
270 2719641986
271 2753569228
272 2792841354
273 2817262693
274 2817276235
275 2817453678
276 2819613992
277 2856291669
278 2857361610
279 2885272277
280 2900643140
281 2902687556
282 2904617802
283 2921647999
284 2923511719
285 2928117748
286 642599263
287 644749835
288 8020809666
289 8040168552
290 8040178343
291 8055268501
292 8055308764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12837

Fer4_6

4Fe-4S binding domain

30

51

0.94

PF00037

Fer4

4Fe-4S binding domain

30

52

0.93

PF12797

Fer4_2

4Fe-4S binding domain

27

48

0.92

PF12800

Fer4_4

4Fe-4S binding domain

85

103

0.92

PF12800

Fer4_4

4Fe-4S binding domain

33

49

0.91

PF13237

Fer4_10

4Fe-4S dicluster domain

29

99

0.9

PF13484

Fer4_16

4Fe-4S double cluster binding domain

35

101

0.83

PF14697

Fer4_21

4Fe-4S dicluster domain

29

105

0.82

PF12838

Fer4_7

4Fe-4S dicluster domain

35

102

0.74

PF13534

Fer4_17

4Fe-4S dicluster domain

35

102

0.68

PF13183

Fer4_8

4Fe-4S dicluster domain

32

102

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
5odi-assembly1.cif.gz_A heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus cocrystallized with com-sh 0.8295 18 83
7npa-assembly4.cif.gz_M crystal structure of the coenzyme f420-dependent sulfite reductase from methanothermococcus thermolithotrophicus at 1.55-a resolution 0.821 16 83
7npa-assembly4.cif.gz_N crystal structure of the coenzyme f420-dependent sulfite reductase from methanothermococcus thermolithotrophicus at 1.55-a resolution 0.8191 16 83
7np8-assembly1.cif.gz_B crystal structure of the coenzyme f420-dependent sulfite reductase from methanocaldococcus jannaschii at 2.3-a resolution 0.8182 15 83
8oh5-assembly1.cif.gz_B cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) 0.8158 21 83
ID Description Score Start End Superfamily
4omfG02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8336 27 79 3.30.70.20
af_Q58565_66_146_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8302 21 87 3.30.70.20
1hfeM02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7898 22 80 3.30.70.20
af_Q55EL3_285_498_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7887 2 14 3.40.50.2020
af_O50433_2_106_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.787 21 82 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A1S9CQM7-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9367 18 87 GO:0046872
GO:0051539
AF-A0A354GSL7-F1-model_v4 Ferredoxin 0.9243 21 83 GO:0046872
GO:0051539
AF-A0A6B9TGX2-F1-model_v4 4Fe-4S dicluster domain-containing protein 0.9187 21 86 GO:0016491
GO:0051539
AF-A0A497IVJ4-F1-model_v4 deleted 0.9138 17 88
AF-R9SM07-F1-model_v4 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein 0.9007 21 87 GO:0016491
GO:0051539

Map