F198216

General Info

Members Datasets Scaffolds Average Seq Length
146 121 138 156

Family's Representative Sequence

Representative Sequence 3300039110|Ga0400487_35120|Ga0400487_35120_16922_17482
Length 186
Sequence MAAPIRPHQQEPTDDHEYCHIDYSGGKKMNEYFIIKWIHILSATLLFGTGLGSAFYKWLTDRSGNLSAMSETNRLVVLADWLFTTPTIIIQPITGIWLLSLMGIPLDQGWVILSIILYIIAGICWLPVVWLQIRMRNMTANINEDIPYIDKGYRYYANLWFSLGIPAFIAMIVVYFLMVFKPSFTI

Samples

Sample ID Description Type Environment
1 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
2 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
3 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
4 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
5 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
6 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
77 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
78 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
84 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
85 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
86 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
87 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
88 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
89 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
90 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
93 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
98 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
99 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
100 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
107 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
121 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 0
Isolates 5.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.16
Nodule 0
Rhizoplane 2.05
Rhizosphere 68.49
Stem 0
Stem Tuber 0
Unclassified 23.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1009099 3300002705 Bacteria 2441
2 JGI25151J46595_10002406 3300003187 Bacteria 11308
3 rootL2_10135433 3300003322 Bacteria 4341
4 Ga0065715_10009163 3300005293 Bacteria 2593
5 Ga0070676_10462747 3300005328 Bacteria 894
6 Ga0070666_10000008 3300005335 Bacteria 293415
7 Ga0070666_10006371 3300005335 Bacteria 7260
8 Ga0070666_10404053 3300005335 Bacteria 982
9 Ga0070680_100398332 3300005336 Bacteria 1173
10 Ga0070689_100904852 3300005340 Bacteria 781
11 Ga0070661_100423685 3300005344 Bacteria 1055
12 Ga0070675_100302940 3300005354 Bacteria 1408
13 Ga0070673_100610749 3300005364 Bacteria 995
14 Ga0070709_10003660 3300005434 Bacteria 8253
15 Ga0070714_101271978 3300005435 Unclassified 718
16 Ga0070711_100385703 3300005439 Bacteria 1134
17 Ga0070678_100163658 3300005456 Bacteria 1805
18 Ga0070681_10010868 3300005458 Bacteria 8998
19 Ga0070695_100002828 3300005545 Bacteria 10084
20 Ga0070665_100419140 3300005548 Bacteria 1347
21 Ga0068856_100210979 3300005614 Bacteria 1957
22 Ga0068852_100417976 3300005616 Bacteria 1322
23 Ga0068859_100086383 3300005617 Bacteria 3184
24 Ga0068851_10433417 3300005834 Bacteria 778
25 Ga0068863_100397834 3300005841 Unclassified 1347
26 Ga0068858_100014148 3300005842 Bacteria 7524
27 Ga0068858_100455364 3300005842 Bacteria 1233
28 Ga0068860_100923714 3300005843 Unclassified 889
29 Ga0075365_10047399 3300006038 Bacteria 2825
30 Ga0070712_101450650 3300006175 Unclassified 599
31 Ga0075366_10086392 3300006195 Bacteria 1876
32 Ga0097621_100090088 3300006237 Bacteria 2566
33 Ga0075370_10015864 3300006353 Bacteria 4043
34 Ga0075431_100332010 3300006847 Bacteria 1531
35 Ga0068865_100284489 3300006881 Bacteria 1318
36 Ga0097620_100086382 3300006931 Bacteria 3184
37 Ga0105251_10000898 3300009011 Bacteria 26671
38 Ga0105244_10016546 3300009036 Bacteria 4198
39 Ga0105250_10026463 3300009092 Bacteria 2336
40 Ga0105250_10041044 3300009092 Bacteria 1855
41 Ga0111539_11355262 3300009094 Bacteria 825
42 Ga0105245_10380522 3300009098 Bacteria 1405
43 Ga0105243_10002208 3300009148 Bacteria 16401
44 Ga0105242_10002660 3300009176 Bacteria 14000
45 Ga0105148_112393 3300009978 Bacteria 660
46 Ga0105239_10002501 3300010375 Bacteria 23399
47 Ga0105239_10065099 3300010375 Bacteria 4002
48 Ga0157369_10404316 3300013105 Bacteria 1416
49 Ga0157374_10657381 3300013296 Bacteria 1060
50 Ga0157379_10685414 3300014968 Bacteria 961
51 Ga0207655_1000033 3300025728 Bacteria 377066
52 Ga0207713_1001237 3300025735 Bacteria 21197
53 Ga0207688_10140859 3300025901 Bacteria 1419
54 Ga0207680_10000005 3300025903 Bacteria 660983
55 Ga0207699_10005616 3300025906 Bacteria 6017
56 Ga0207699_10438794 3300025906 Bacteria 935
57 Ga0207707_10008137 3300025912 Bacteria 9106
58 Ga0207660_10345476 3300025917 Bacteria 1192
59 Ga0207649_10494279 3300025920 Bacteria 930
60 Ga0207686_10051120 3300025934 Bacteria 2573
61 Ga0207709_10004650 3300025935 Bacteria 7895
62 Ga0207709_10010175 3300025935 Bacteria 5180
63 Ga0207691_10659463 3300025940 Bacteria 884
64 Ga0207651_11138346 3300025960 Bacteria 700
65 Ga0207703_10423163 3300026035 Bacteria 1240
66 Ga0207703_10550996 3300026035 Bacteria 1087
67 Ga0207702_10176064 3300026078 Bacteria 1966
68 Ga0207648_10115187 3300026089 Bacteria 2362
69 Ga0207648_10127594 3300026089 Bacteria 2238
70 Ga0207683_10216999 3300026121 Bacteria 1742
71 Ga0268264_10455071 3300028381 Bacteria 1241
72 Ga0307515_10021628 3300028794 Bacteria 11390
73 Ga0307405_10012820 3300031731 Bacteria 4453
74 Ga0307518_10268879 3300031838 Bacteria 1066
75 Ga0307406_10002847 3300031901 Bacteria 9425
76 Ga0307412_10375733 3300031911 Bacteria 1149
77 Ga0307416_100335845 3300032002 Bacteria 1521
78 Ga0307411_10977032 3300032005 Bacteria 757
79 Ga0316583_10033756 3300032133 Unclassified 1817
80 Ga0307507_10107609 3300033179 Bacteria 2297
81 Ga0307510_10406039 3300033180 Bacteria 805
82 Ga0395900_0015858 3300037418 Bacteria 7678
83 Ga0395900_0120594 3300037418 Bacteria 2691
84 Ga0395898_0043152 3300037466 Unclassified 4445
85 Ga0395905_0002070 3300037471 Bacteria 22838
86 Ga0395905_0066874 3300037471 Bacteria 3366
87 Ga0395905_0169583 3300037471 Bacteria 2050
88 Ga0395905_0218064 3300037471 Bacteria 1786
89 Ga0395901_0061357 3300038443 Unclassified 3912
90 Ga0400484_20913 3300038725 Bacteria 1213
91 Ga0400490_00715 3300038726 Bacteria 87348
92 Ga0400485_18080 3300038735 Bacteria 9056
93 Ga0400485_19863 3300038735 Bacteria 101440
94 Ga0400488_16473 3300038741 Bacteria 27359
95 Ga0400488_20994 3300038741 Bacteria 3453
96 Ga0400488_36541 3300038741 Bacteria 1229
97 Ga0400486_19188 3300038742 Bacteria 196185
98 Ga0400486_25532 3300038742 Bacteria 6727
99 Ga0400483_042789 3300039062 Bacteria 10353
100 Ga0400483_147385 3300039062 Bacteria 5634
101 Ga0400483_155017 3300039062 Bacteria 2313
102 Ga0400483_174590 3300039062 Bacteria 3825
103 Ga0400483_272176 3300039062 Bacteria 1388
104 Ga0400489_68145 3300039093 Bacteria 1204
105 Ga0400487_24899 3300039110 Bacteria 31974
106 Ga0400487_35120 3300039110 Bacteria 88723
107 Ga0400487_38000 3300039110 Bacteria 182775
108 Ga0400487_55087 3300039110 Bacteria 2176
109 Ga0436360_0585972 3300039438 Unclassified 701
110 Ga0439438_007791 3300041405 Bacteria 3618
111 Ga0439447_007930 3300041407 Bacteria 3327
112 Ga0451807_2577742 3300041486 Bacteria 2401
113 Ga0451851_1020137 3300041507 Bacteria 736
114 Ga0451853_0036479 3300041512 Bacteria 842
115 Ga0439445_0075604 3300042004 Bacteria 936
116 Ga0439446_0001981 3300042156 Bacteria 4837
117 Ga0450909_001743 3300042185 Bacteria 3057
118 Ga0439435_0015734 3300042436 Bacteria 1887
119 Ga0453684_0003828 3300044712 Bacteria 33189
120 Ga0466967_1513988 3300045976 Bacteria 668
121 Ga0495630_0604065 3300046517 Unclassified 841
122 Ga0495652_0433068 3300046529 Bacteria 924
123 Ga0495640_0455169 3300046533 Unclassified 781
124 Ga0495679_011775 3300047446 Bacteria 3359
125 Ga0495626_0013650 3300048091 Bacteria 4215
126 Ga0496100_0075762 3300048903 Bacteria 2257
127 Ga0496110_0024303 3300048913 Bacteria 5163
128 Ga0496121_0125634 3300048924 Bacteria 1929
129 Ga0496122_0028730 3300048925 Bacteria 4708
130 Ga0496123_0016954 3300048926 Bacteria 5884
131 Ga0496124_0212796 3300048927 Bacteria 1461
132 Ga0496126_0248158 3300048929 Bacteria 1484
133 nmdc:mga03683_66262_c1 3300050489 Bacteria 1535
134 nmdc:mga0k408_536374_c1 3300050493 Unclassified 692
135 nmdc:mga0k408_9152_c2 3300050493 Bacteria 2275
136 nmdc:mga07m45_7957_c1 3300050496 Bacteria 5431
137 nmdc:mga06r32_664978_c1 3300050510 Bacteria 1009
138 nmdc:mga0sz30_336301_c1 3300050516 Bacteria 674

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0066874 Ga0395905_0066874_2361_2825 138
2 iso_pu_bacteria 2919527303 2919533225 150
3 iso_pu_bacteria 2860867994 2860872992 151
4 iso_pu_bacteria 2908446538 2908452537 151
5 iso_pu_bacteria 2945928738 2945930949 151
6 iso_pu_bacteria 2946006987 2946013330 151
7 iso_pu_bacteria 3007419365 3007425699 151
8 iso_pu_bacteria 8055817908 8055823863 151
9 iso_pu_bacteria 8056161164 8056163595 151
10 3300037471 Ga0395905_0218064 Ga0395905_0218064_108_566 152
11 3300009978 Ga0105148_112393 Ga0105148_1123932 153
12 3300005340 Ga0070689_100904852 Ga0070689_1009048522 154
13 3300005344 Ga0070661_100423685 Ga0070661_1004236852 154
14 3300005354 Ga0070675_100302940 Ga0070675_1003029402 154
15 3300005364 Ga0070673_100610749 Ga0070673_1006107492 154
16 3300005614 Ga0068856_100210979 Ga0068856_1002109792 154
17 3300005616 Ga0068852_100417976 Ga0068852_1004179763 154
18 3300005617 Ga0068859_100086383 Ga0068859_1000863832 154
19 3300005842 Ga0068858_100455364 Ga0068858_1004553642 154
20 3300006038 Ga0075365_10047399 Ga0075365_100473993 154
21 3300006847 Ga0075431_100332010 Ga0075431_1003320101 154
22 3300006931 Ga0097620_100086382 Ga0097620_1000863822 154
23 3300009094 Ga0111539_11355262 Ga0111539_113552621 154
24 3300010375 Ga0105239_10065099 Ga0105239_100650994 154
25 3300014968 Ga0157379_10685414 Ga0157379_106854141 154
26 3300025901 Ga0207688_10140859 Ga0207688_101408593 154
27 3300025920 Ga0207649_10494279 Ga0207649_104942792 154
28 3300025940 Ga0207691_10659463 Ga0207691_106594631 154
29 3300025960 Ga0207651_11138346 Ga0207651_111383461 154
30 3300026035 Ga0207703_10423163 Ga0207703_104231632 154
31 3300026078 Ga0207702_10176064 Ga0207702_101760643 154
32 3300031901 Ga0307406_10002847 Ga0307406_100028473 154
33 3300033179 Ga0307507_10107609 Ga0307507_101076092 154
34 3300033180 Ga0307510_10406039 Ga0307510_104060392 154
35 3300037418 Ga0395900_0120594 Ga0395900_0120594_2058_2522 154
36 3300037471 Ga0395905_0169583 Ga0395905_0169583_1428_1892 154
37 3300041486 Ga0451807_2577742 Ga0451807_2577742_630_1094 154
38 3300041507 Ga0451851_1020137 Ga0451851_1020137_162_626 154
39 3300041512 Ga0451853_0036479 Ga0451853_0036479_368_832 154
40 3300042156 Ga0439446_0001981 Ga0439446_0001981_1982_2446 154
41 3300042436 Ga0439435_0015734 Ga0439435_0015734_59_523 154
42 3300045976 Ga0466967_1513988 Ga0466967_1513988_149_613 154
43 3300050489 nmdc:mga03683_66262_c1 nmdc:mga03683_66262_c1_508_972 154
44 3300050493 nmdc:mga0k408_536374_c1 nmdc:mga0k408_536374_c1_193_657 154
45 3300050510 nmdc:mga06r32_664978_c1 nmdc:mga06r32_664978_c1_46_510 154
46 3300050516 nmdc:mga0sz30_336301_c1 nmdc:mga0sz30_336301_c1_166_630 154
47 3300005293 Ga0065715_10009163 Ga0065715_100091632 155
48 3300005328 Ga0070676_10462747 Ga0070676_104627472 155
49 3300005335 Ga0070666_10404053 Ga0070666_104040532 155
50 3300005548 Ga0070665_100419140 Ga0070665_1004191402 155
51 3300005842 Ga0068858_100014148 Ga0068858_1000141487 155
52 3300005843 Ga0068860_100923714 Ga0068860_1009237142 155
53 3300009011 Ga0105251_10000898 Ga0105251_1000089823 155
54 3300009036 Ga0105244_10016546 Ga0105244_100165464 155
55 3300009092 Ga0105250_10026463 Ga0105250_100264631 155
56 3300009092 Ga0105250_10041044 Ga0105250_100410442 155
57 3300009148 Ga0105243_10002208 Ga0105243_100022087 155
58 3300009176 Ga0105242_10002660 Ga0105242_100026609 155
59 3300013105 Ga0157369_10404316 Ga0157369_104043162 155
60 3300025728 Ga0207655_1000033 Ga0207655_100003327 155
61 3300025735 Ga0207713_1001237 Ga0207713_10012374 155
62 3300025934 Ga0207686_10051120 Ga0207686_100511201 155
63 3300025935 Ga0207709_10004650 Ga0207709_100046504 155
64 3300026035 Ga0207703_10550996 Ga0207703_105509962 155
65 3300026089 Ga0207648_10127594 Ga0207648_101275943 155
66 3300028794 Ga0307515_10021628 Ga0307515_1002162811 155
67 3300031731 Ga0307405_10012820 Ga0307405_100128202 155
68 3300031838 Ga0307518_10268879 Ga0307518_102688791 155
69 3300031911 Ga0307412_10375733 Ga0307412_103757332 155
70 3300032002 Ga0307416_100335845 Ga0307416_1003358452 155
71 3300032005 Ga0307411_10977032 Ga0307411_109770322 155
72 3300037418 Ga0395900_0015858 Ga0395900_0015858_7050_7517 155
73 3300037466 Ga0395898_0043152 Ga0395898_0043152_2213_2680 155
74 3300037471 Ga0395905_0002070 Ga0395905_0002070_3759_4226 155
75 3300038443 Ga0395901_0061357 Ga0395901_0061357_1480_1947 155
76 3300039438 Ga0436360_0585972 Ga0436360_0585972_36_503 155
77 3300041405 Ga0439438_007791 Ga0439438_007791_2414_2881 155
78 3300042004 Ga0439445_0075604 Ga0439445_0075604_388_855 155
79 3300042185 Ga0450909_001743 Ga0450909_001743_593_1060 155
80 3300046517 Ga0495630_0604065 Ga0495630_0604065_25_492 155
81 3300046529 Ga0495652_0433068 Ga0495652_0433068_163_630 155
82 3300046533 Ga0495640_0455169 Ga0495640_0455169_208_675 155
83 3300047446 Ga0495679_011775 Ga0495679_011775_2202_2669 155
84 3300005336 Ga0070680_100398332 Ga0070680_1003983322 156
85 3300005434 Ga0070709_10003660 Ga0070709_100036604 156
86 3300005435 Ga0070714_101271978 Ga0070714_1012719781 156
87 3300005439 Ga0070711_100385703 Ga0070711_1003857032 156
88 3300005458 Ga0070681_10010868 Ga0070681_100108682 156
89 3300005545 Ga0070695_100002828 Ga0070695_1000028282 156
90 3300006175 Ga0070712_101450650 Ga0070712_1014506502 156
91 3300025906 Ga0207699_10005616 Ga0207699_100056166 156
92 3300025906 Ga0207699_10438794 Ga0207699_104387941 156
93 3300025912 Ga0207707_10008137 Ga0207707_100081372 156
94 3300025917 Ga0207660_10345476 Ga0207660_103454762 156
95 3300048091 Ga0495626_0013650 Ga0495626_0013650_2507_2977 156
96 3300048903 Ga0496100_0075762 Ga0496100_0075762_123_593 156
97 3300003322 rootL2_10135433 rootL2_101354332 157
98 3300005335 Ga0070666_10006371 Ga0070666_100063714 157
99 3300005834 Ga0068851_10433417 Ga0068851_104334172 157
100 3300005841 Ga0068863_100397834 Ga0068863_1003978342 157
101 3300006237 Ga0097621_100090088 Ga0097621_1000900882 157
102 3300006881 Ga0068865_100284489 Ga0068865_1002844892 157
103 3300009098 Ga0105245_10380522 Ga0105245_103805222 157
104 3300010375 Ga0105239_10002501 Ga0105239_100025013 157
105 3300013296 Ga0157374_10657381 Ga0157374_106573812 157
106 3300032133 Ga0316583_10033756 Ga0316583_100337562 157
107 3300038725 Ga0400484_20913 Ga0400484_20913_372_845 157
108 3300038735 Ga0400485_18080 Ga0400485_18080_3631_4104 157
109 3300038742 Ga0400486_25532 Ga0400486_25532_3619_4092 157
110 3300039062 Ga0400483_042789 Ga0400483_042789_2130_2603 157
111 3300039062 Ga0400483_147385 Ga0400483_147385_524_997 157
112 3300039062 Ga0400483_174590 Ga0400483_174590_1361_1834 157
113 3300039110 Ga0400487_55087 Ga0400487_55087_426_899 157
114 3300041407 Ga0439447_007930 Ga0439447_007930_121_594 157
115 3300044712 Ga0453684_0003828 Ga0453684_0003828_31726_32199 157
116 3300002705 JGI25156J39149_1009099 JGI25156J39149_10090991 158
117 3300003187 JGI25151J46595_10002406 JGI25151J46595_100024062 158
118 3300005335 Ga0070666_10000008 Ga0070666_10000008201 158
119 3300005456 Ga0070678_100163658 Ga0070678_1001636582 158
120 3300006195 Ga0075366_10086392 Ga0075366_100863922 158
121 3300006353 Ga0075370_10015864 Ga0075370_100158642 158
122 3300025903 Ga0207680_10000005 Ga0207680_1000000540 158
123 3300025935 Ga0207709_10010175 Ga0207709_100101752 158
124 3300026089 Ga0207648_10115187 Ga0207648_101151872 158
125 3300026121 Ga0207683_10216999 Ga0207683_102169992 158
126 3300028381 Ga0268264_10455071 Ga0268264_104550712 158
127 3300038726 Ga0400490_00715 Ga0400490_00715_73194_73670 158
128 3300038735 Ga0400485_19863 Ga0400485_19863_85125_85601 158
129 3300038741 Ga0400488_16473 Ga0400488_16473_23452_23928 158
130 3300038741 Ga0400488_20994 Ga0400488_20994_973_1452 158
131 3300038741 Ga0400488_36541 Ga0400488_36541_82_558 158
132 3300038742 Ga0400486_19188 Ga0400486_19188_178178_178654 158
133 3300039062 Ga0400483_155017 Ga0400483_155017_588_1067 158
134 3300039062 Ga0400483_272176 Ga0400483_272176_787_1266 158
135 3300039093 Ga0400489_68145 Ga0400489_68145_195_674 158
136 3300039110 Ga0400487_24899 Ga0400487_24899_29825_30304 158
137 3300039110 Ga0400487_35120 Ga0400487_35120_16922_17482 158
138 3300039110 Ga0400487_38000 Ga0400487_38000_8614_9090 158
139 3300048913 Ga0496110_0024303 Ga0496110_0024303_343_834 158
140 3300048924 Ga0496121_0125634 Ga0496121_0125634_700_1176 158
141 3300048925 Ga0496122_0028730 Ga0496122_0028730_1747_2232 158
142 3300048926 Ga0496123_0016954 Ga0496123_0016954_649_1134 158
143 3300048927 Ga0496124_0212796 Ga0496124_0212796_449_937 158
144 3300048929 Ga0496126_0248158 Ga0496126_0248158_220_696 158
145 3300050493 nmdc:mga0k408_9152_c2 nmdc:mga0k408_9152_c2_238_714 158
146 3300050496 nmdc:mga07m45_7957_c1 nmdc:mga07m45_7957_c1_630_1106 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10027

DUF2269

Predicted integral membrane protein (DUF2269)

33

182

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.6451 8 156
3jbk-assembly1.cif.gz_M cryo-em reconstruction of the metavinculin-actin interface 0.6333 18 155
3jbk-assembly1.cif.gz_M cryo-em reconstruction of the metavinculin-actin interface 0.6182 18 155
1y4c-assembly1.cif.gz_A designed helical protein fusion mbp 0.6176 7 143
1m56-assembly1.cif.gz_C structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type) 0.6067 10 149
ID Description Score Start End Superfamily
af_A0A1P8B3M4_437_547_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.7763 76 146 1.20.58.390
af_K7M4Z9_552_665_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7635 77 149 1.20.140.150
af_K7M174_618_732_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7619 79 149 1.20.140.150
af_A0A1D6ML49_3_186_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.672 4 149 1.20.1410.10
af_Q7HP05_85_278_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.6691 8 149 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A562PN92-F1-model_v4 Putative membrane protein 0.9899 4 154 GO:0016020
AF-A0A078LV02-F1-model_v4 Integral membrane protein 0.9856 1 154 GO:0016020
AF-A0A7U0FZP2-F1-model_v4 deleted 0.9855 4 154
AF-A0A261TQQ4-F1-model_v4 DUF2269 domain-containing protein 0.985 4 154 GO:0016020
AF-A0A833ISB2-F1-model_v4 DUF2269 domain-containing protein 0.9849 4 154 GO:0016020

Feature Viewer

pLDDT pTM Quality
93.56 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map