F198310

General Info

Members Datasets Scaffolds Average Seq Length
146 106 292 225

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0000400|Ga0466972_0000400_17444_18163
Length 239
Sequence MFLFCILNEETMIQQQHSINWITFLLAWVAGFCDTATFVAGDSIFSAHVTGNFIVFAAQVTSDSNPVASWLKLLTFPVFIGAVMVGGLIAEKSQRKYKILYTEGMILMFCGLAAILLPMIKGFDENIIVYIVVMTTVVGMGLQNAFGKLFAKETLGPTTMMTGNVTQASLDWGNLIRKGKKADGQSWISFKKQLITIGGFLAGCIIGAVLSKWLGLGAIIIPGVAIVICYLVGESAQLN

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
11 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
12 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
13 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
14 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
15 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
16 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
22 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
23 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
24 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
25 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
26 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
27 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
34 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
37 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
40 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
41 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
42 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
46 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
47 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
48 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
49 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
50 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
51 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
52 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
53 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
54 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
55 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
56 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
57 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
58 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
59 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
60 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
61 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
62 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
63 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
64 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
65 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
66 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
67 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
68 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
69 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
70 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
71 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
72 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
73 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
74 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
75 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
76 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
77 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
78 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
79 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
80 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
81 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
82 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
83 2738541283 Pedobacter sp. OK701 Isolate Unclassified
84 2738541302 Pedobacter sp. CF074 Isolate Unclassified
85 2739367656 Pedobacter sp. CF523 Isolate Unclassified
86 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
87 2818991437 Pedobacter terrae 518 Isolate Unclassified
88 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
89 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
90 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
91 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
92 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
93 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
94 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
95 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
96 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
97 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
98 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
99 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
100 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
101 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
102 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
103 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
104 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
105 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
106 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.19
Metatranscriptomes 0
Isolates 17.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0.68
Rhizoplane 0
Rhizosphere 71.92
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0000400 3300044658 Bacteria 22988
2 rootH1_10016127 3300003316 Bacteria 11418
3 rootH1_10165872 3300003316 Bacteria 2832
4 rootH1_10189442 3300003316 Bacteria 1359
5 rootH2_10034245 3300003320 Bacteria 9748
6 rootH2_10098603 3300003320 Bacteria 4197
7 rootH2_10246219 3300003320 Bacteria 1891
8 rootL2_10060643 3300003322 Bacteria 7724
9 rootL2_10146190 3300003322 Bacteria 2852
10 rootH1_10100241 3300003323 Bacteria 6339
11 rootH1_10111040 3300003323 Bacteria 9739
12 rootH1_10125743 3300003323 Unclassified 4440
13 Ga0065714_10002188 3300005288 Bacteria 166479
14 Ga0065714_10079453 3300005288 Bacteria 2515
15 Ga0065704_10071740 3300005289 Bacteria 10048
16 Ga0065715_10097413 3300005293 Bacteria 3709
17 Ga0065715_10097633 3300005293 Bacteria 3674
18 Ga0068857_100351738 3300005577 Bacteria 1364
19 Ga0079104_1000005 3300006946 Bacteria 407099
20 Ga0105244_10000007 3300009036 Bacteria 352275
21 Ga0105240_10000008 3300009093 Bacteria 618862
22 Ga0105240_10203014 3300009093 Bacteria 2322
23 Ga0105237_10001667 3300009545 Bacteria 28757
24 Ga0105239_10183141 3300010375 Bacteria 2344
25 Ga0157373_10000002 3300013100 Bacteria 750094
26 Ga0157371_10000085 3300013102 Bacteria 148566
27 Ga0157371_10404783 3300013102 Bacteria 999
28 Ga0157370_10000061 3300013104 Bacteria 115933
29 Ga0157370_10000358 3300013104 Bacteria 57816
30 Ga0157370_10049084 3300013104 Bacteria 4042
31 Ga0157369_10000004 3300013105 Bacteria 479764
32 Ga0163162_10002896 3300013306 Bacteria 16339
33 Ga0157372_10495679 3300013307 Bacteria 1424
34 Ga0163163_10104517 3300014325 Bacteria 2858
35 Ga0182008_10000273 3300014497 Bacteria 40454
36 Ga0182006_1000011 3300015261 Bacteria 408647
37 Ga0182006_1000441 3300015261 Bacteria 32970
38 Ga0182006_1001471 3300015261 Bacteria 14177
39 Ga0182007_10000006 3300015262 Bacteria 427355
40 Ga0163161_10001241 3300017792 Bacteria 19105
41 Ga0163161_10001718 3300017792 Bacteria 16045
42 Ga0163161_10001877 3300017792 Bacteria 15336
43 Ga0163161_10014762 3300017792 Bacteria 5441
44 Ga0209436_100697 3300025208 Bacteria 14138
45 Ga0209130_1001821 3300025284 Bacteria 12351
46 Ga0207426_1000114 3300025302 Bacteria 228273
47 Ga0207655_1000066 3300025728 Bacteria 246358
48 Ga0207695_10000021 3300025913 Bacteria 679399
49 Ga0207695_10086355 3300025913 Bacteria 3164
50 Ga0207671_10008670 3300025914 Bacteria 8584
51 Ga0207674_10426037 3300026116 Bacteria 1282
52 Ga0265327_10000010 3300031251 Bacteria 566817
53 Ga0307405_10000018 3300031731 Bacteria 182495
54 Ga0307405_10000027 3300031731 Bacteria 118118
55 Ga0307413_10000005 3300031824 Bacteria 67023
56 Ga0307407_10000104 3300031903 Bacteria 28193
57 Ga0307412_10000196 3300031911 Bacteria 41764
58 Ga0307416_100000052 3300032002 Bacteria 114516
59 Ga0307416_100000060 3300032002 Bacteria 102377
60 Ga0307414_10003847 3300032004 Bacteria 8075
61 Ga0307414_10054727 3300032004 Bacteria 2790
62 Ga0307414_10326313 3300032004 Bacteria 1308
63 Ga0307414_10394741 3300032004 Bacteria 1200
64 Ga0307414_10455058 3300032004 Bacteria 1123
65 Ga0307411_10000001 3300032005 Bacteria 931810
66 Ga0307510_10004785 3300033180 Bacteria 16016
67 Ga0395899_0292863 3300037312 Bacteria 1104
68 Ga0395900_0146745 3300037418 Bacteria 2412
69 Ga0395905_0004573 3300037471 Bacteria 14315
70 Ga0436361_0649758 3300039447 Bacteria 4836
71 Ga0439439_0094588 3300041406 Unclassified 819
72 Ga0439447_017809 3300041407 Bacteria 1929
73 Ga0439433_0012388 3300041999 Bacteria 1869
74 Ga0495627_000003 3300046453 Bacteria 704557
75 Ga0495638_0047517 3300046460 Bacteria 2690
76 Ga0495650_0000023 3300046471 Bacteria 527763
77 Ga0495583_0053543 3300046506 Bacteria 1831
78 Ga0495606_0000060 3300046507 Bacteria 185907
79 Ga0495606_0009459 3300046507 Bacteria 8247
80 Ga0495606_0026436 3300046507 Bacteria 4138
81 Ga0495610_0000001 3300046512 Bacteria 1620061
82 Ga0495610_0000263 3300046512 Bacteria 54974
83 Ga0495610_0001375 3300046512 Bacteria 21610
84 Ga0495616_0000540 3300046513 Bacteria 28554
85 Ga0495637_0064852 3300046520 Bacteria 1489
86 Ga0495648_0007622 3300046524 Bacteria 8637
87 Ga0495652_0102823 3300046529 Bacteria 2314
88 Ga0495652_0250817 3300046529 Bacteria 1312
89 Ga0495654_0000001 3300046530 Bacteria 1513197
90 Ga0495622_0103287 3300046557 Bacteria 1305
91 Ga0495633_0000002 3300046558 Bacteria 488754
92 Ga0495633_0030932 3300046558 Bacteria 2599
93 Ga0495668_0000134 3300046616 Bacteria 112135
94 Ga0495668_0003857 3300046616 Bacteria 10962
95 Ga0495611_0000367 3300046648 Bacteria 29199
96 Ga0495625_0000018 3300046660 Bacteria 299567
97 Ga0495625_0013278 3300046660 Bacteria 6626
98 Ga0495661_0004755 3300046665 Bacteria 9744
99 Ga0495661_0026342 3300046665 Bacteria 3746
100 Ga0495661_0031413 3300046665 Bacteria 3371
101 Ga0495649_0000111 3300046694 Bacteria 71877
102 Ga0495649_0172627 3300046694 Bacteria 1130
103 Ga0495660_0159656 3300046810 Bacteria 1106
104 Ga0495687_000220 3300047443 Bacteria 80993
105 Ga0495686_0000812 3300047472 Bacteria 40457
106 Ga0495686_0001573 3300047472 Bacteria 24190
107 Ga0495686_0007997 3300047472 Bacteria 7842
108 Ga0495686_0023342 3300047472 Bacteria 4081
109 Ga0495686_0182323 3300047472 Unclassified 1216
110 Ga0496121_0014931 3300048924 Bacteria 8183
111 Ga0496122_0001694 3300048925 Bacteria 34182
112 Ga0496123_0006516 3300048926 Bacteria 11285
113 Ga0496124_0324428 3300048927 Bacteria 1101
114 Ga0501249_047821 3300049679 Bacteria 978
115 Ga0501266_000005 3300049763 Bacteria 346750
116 Ga0500641_0000017 3300053096 Bacteria 132678
117 Ga0500618_019684 3300053125 Bacteria 1659
118 Ga0500658_0000024 3300053134 Bacteria 117952
119 Ga0500573_0160154 3300053140 Bacteria 1226
120 Ga0500584_027809 3300053726 Bacteria 2629
121 2587943227 2585428115 Bacteria 4420269
122 2644684940 2643221725 Bacteria 5087956
123 2738758826 2738541283 Bacteria 7222293
124 2738853077 2738541302 Bacteria 5944758
125 2739618087 2739367656 Bacteria 5152243
126 2802653863 2802428842 Bacteria 4926114
127 2819548724 2818991437 Bacteria 5805520
128 2819681474 2818991460 Bacteria 7595395
129 2842087985 2842083920 Bacteria 4857652
130 2842725791 2842722452 Bacteria 6263924
131 2842913005 2842909656 Bacteria 6185908
132 2857622946 2857618242 Bacteria 5635925
133 2857630862 2857627736 Bacteria 5625397
134 2881361938 2881359912 Bacteria 4935907
135 2884795300 2884791551 Bacteria 8511252
136 2919441596 2919437846 Bacteria 6199444
137 2929153226 2929150217 Bacteria 5462483
138 2929181620 2929177148 Bacteria 7883697
139 2945927320 2945924605 Bacteria 4296724
140 2945984036 2945977869 Bacteria 7777518
141 2946001407 2945997725 Bacteria 6404843
142 2946016572 2946013367 Bacteria 7766675
143 2954017976 2954016120 Bacteria 6446024
144 2977233289 2977232053 Bacteria 5485925
145 2977270033 2977268062 Bacteria 5243061
146 2993484418 2993480792 Bacteria 4022225
147 Ga0466972_0000400
148 rootH1_10016127
149 rootH1_10165872
150 rootH1_10189442
151 rootH2_10034245
152 rootH2_10098603
153 rootH2_10246219
154 rootL2_10060643
155 rootL2_10146190
156 rootH1_10100241
157 rootH1_10111040
158 rootH1_10125743
159 Ga0065714_10002188
160 Ga0065714_10079453
161 Ga0065704_10071740
162 Ga0065715_10097413
163 Ga0065715_10097633
164 Ga0068857_100351738
165 Ga0079104_1000005
166 Ga0105244_10000007
167 Ga0105240_10000008
168 Ga0105240_10203014
169 Ga0105237_10001667
170 Ga0105239_10183141
171 Ga0157373_10000002
172 Ga0157371_10000085
173 Ga0157371_10404783
174 Ga0157370_10000061
175 Ga0157370_10000358
176 Ga0157370_10049084
177 Ga0157369_10000004
178 Ga0163162_10002896
179 Ga0157372_10495679
180 Ga0163163_10104517
181 Ga0182008_10000273
182 Ga0182006_1000011
183 Ga0182006_1000441
184 Ga0182006_1001471
185 Ga0182007_10000006
186 Ga0163161_10001241
187 Ga0163161_10001718
188 Ga0163161_10001877
189 Ga0163161_10014762
190 Ga0209436_100697
191 Ga0209130_1001821
192 Ga0207426_1000114
193 Ga0207655_1000066
194 Ga0207695_10000021
195 Ga0207695_10086355
196 Ga0207671_10008670
197 Ga0207674_10426037
198 Ga0265327_10000010
199 Ga0307405_10000018
200 Ga0307405_10000027
201 Ga0307413_10000005
202 Ga0307407_10000104
203 Ga0307412_10000196
204 Ga0307416_100000052
205 Ga0307416_100000060
206 Ga0307414_10003847
207 Ga0307414_10054727
208 Ga0307414_10326313
209 Ga0307414_10394741
210 Ga0307414_10455058
211 Ga0307411_10000001
212 Ga0307510_10004785
213 Ga0395899_0292863
214 Ga0395900_0146745
215 Ga0395905_0004573
216 Ga0436361_0649758
217 Ga0439439_0094588
218 Ga0439447_017809
219 Ga0439433_0012388
220 Ga0495627_000003
221 Ga0495638_0047517
222 Ga0495650_0000023
223 Ga0495583_0053543
224 Ga0495606_0000060
225 Ga0495606_0009459
226 Ga0495606_0026436
227 Ga0495610_0000001
228 Ga0495610_0000263
229 Ga0495610_0001375
230 Ga0495616_0000540
231 Ga0495637_0064852
232 Ga0495648_0007622
233 Ga0495652_0102823
234 Ga0495652_0250817
235 Ga0495654_0000001
236 Ga0495622_0103287
237 Ga0495633_0000002
238 Ga0495633_0030932
239 Ga0495668_0000134
240 Ga0495668_0003857
241 Ga0495611_0000367
242 Ga0495625_0000018
243 Ga0495625_0013278
244 Ga0495661_0004755
245 Ga0495661_0026342
246 Ga0495661_0031413
247 Ga0495649_0000111
248 Ga0495649_0172627
249 Ga0495660_0159656
250 Ga0495687_000220
251 Ga0495686_0000812
252 Ga0495686_0001573
253 Ga0495686_0007997
254 Ga0495686_0023342
255 Ga0495686_0182323
256 Ga0496121_0014931
257 Ga0496122_0001694
258 Ga0496123_0006516
259 Ga0496124_0324428
260 Ga0501249_047821
261 Ga0501266_000005
262 Ga0500641_0000017
263 Ga0500618_019684
264 Ga0500658_0000024
265 Ga0500573_0160154
266 Ga0500584_027809
267 2587943227
268 2644684940
269 2738758826
270 2738853077
271 2739618087
272 2802653863
273 2819548724
274 2819681474
275 2842087985
276 2842725791
277 2842913005
278 2857622946
279 2857630862
280 2881361938
281 2884795300
282 2919441596
283 2929153226
284 2929181620
285 2945927320
286 2945984036
287 2946001407
288 2946016572
289 2954017976
290 2977233289
291 2977270033
292 2993484418

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06912

DUF1275

Protein of unknown function (DUF1275)

22

232

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sc3-assembly1.cif.gz_A human oct1 bound to fenoterol in inward-open conformation 0.609 5 215
4oaa-assembly1.cif.gz_B crystal structure of e. coli lactose permease g46w,g262w bound to sugar 0.6037 6 215
8sdz-assembly1.cif.gz_A structure of rat organic anion transporter 1 (oat1) in complex with probenecid 0.5945 10 218
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.5892 1 220
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.5847 8 215
ID Description Score Start End Superfamily
af_F1QN13_131_525_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.681 1 215 1.20.1250.20
af_I1M3G2_109_523_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6763 8 215 1.20.1250.20
af_A0A1D6PQ92_1_255_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6691 1 215 1.20.1250.20
af_A0A1D6FKK2_52_340_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6688 2 215 1.20.1250.20
af_O96186_278_457_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6627 8 216 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7L8UI92-F1-model_v4 DUF1275 domain-containing protein 0.9611 1 216 GO:0016020
AF-A0A4Z0EJE1-F1-model_v4 DUF1275 domain-containing protein 0.9559 2 225
AF-A0A7G5E3V1-F1-model_v4 DUF1275 domain-containing protein 0.9477 2 221 GO:0016020
AF-A0A3G6TUI6-F1-model_v4 deleted 0.9431 3 220
AF-I2GLS4-F1-model_v4 DUF1275 domain-containing protein 0.943 6 213 GO:0016020

Map