F198517

General Info

Members Datasets Scaffolds Average Seq Length
146 110 292 179

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0000451|Ga0495625_0000451_6347_6964
Length 205
Sequence VQHALSHRNVLEEEMKTKTSRAALFAVLGAATLMTAGCATETAYRPATGTGFARAGYSDRMIEPNRFMVSFAGNTYTARDTVERYLLYRAAELTVQHGYDYFILSDRQTDRRSRTYTTPSAFGPGPYGYWGPSWRYRGRGFGWRSWDPFWGXXXXDRGVDINTVDKYEANAEIVLGRGPKPRDNVRAFDAREVMRNLGPSIVTPQ

Samples

Sample ID Description Type Environment
1 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
83 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
84 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
87 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
92 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
95 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
96 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
97 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
98 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
99 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
100 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
101 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
102 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
103 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
104 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
105 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
106 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
107 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
108 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
109 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
110 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 93.84
Metatranscriptomes 1.37
Isolates 4.79

Biome Distribution

Category Percentage (%)
Aerial Root 2.05
Bulb 0
Endosphere 12.33
Nodule 0
Rhizoplane 2.05
Rhizosphere 76.03
Stem 0
Stem Tuber 0
Unclassified 4.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495625_0000451 3300046660 Bacteria 61644
2 JGI24739J22299_10005309 3300001989 Bacteria 4907
3 JGI24737J22298_10005653 3300001990 Bacteria 4305
4 JGI24735J21928_10001441 3300002067 Bacteria 8410
5 JGI24738J21930_10000585 3300002075 Bacteria 10462
6 JGI25165J46597_1000053 3300003214 Bacteria 235857
7 rootH2_10134643 3300003320 Bacteria 1288
8 rootL2_10098888 3300003322 Bacteria 1879
9 Ga0058863_11658733 3300004799 Bacteria 625
10 Ga0058862_12369427 3300004803 Bacteria 812
11 Ga0065165_1002844 3300005262 Bacteria 13468
12 Ga0068869_100218946 3300005334 Bacteria 1508
13 Ga0070666_10536347 3300005335 Bacteria 850
14 Ga0070668_100003920 3300005347 Bacteria 10992
15 Ga0070659_100277069 3300005366 Bacteria 1395
16 Ga0070662_100160360 3300005457 Bacteria 1759
17 Ga0068853_100738584 3300005539 Bacteria 940
18 Ga0070672_100424672 3300005543 Bacteria 1142
19 Ga0068855_100544110 3300005563 Bacteria 1257
20 Ga0070664_100088806 3300005564 Bacteria 2673
21 Ga0068857_100126115 3300005577 Bacteria 2307
22 Ga0068854_100403287 3300005578 Bacteria 1132
23 Ga0068852_100521865 3300005616 Unclassified 1185
24 Ga0068859_100186441 3300005617 Bacteria 2158
25 Ga0068864_100003879 3300005618 Bacteria 12309
26 Ga0068864_100366346 3300005618 Bacteria 1363
27 Ga0068861_100243152 3300005719 Bacteria 1532
28 Ga0068858_100000423 3300005842 Bacteria 44051
29 Ga0068858_100001286 3300005842 Bacteria 25909
30 Ga0068860_100504638 3300005843 Unclassified 1208
31 Ga0068862_101001024 3300005844 Unclassified 827
32 Ga0075366_10081938 3300006195 Bacteria 1928
33 Ga0075370_10092241 3300006353 Bacteria 1748
34 Ga0068871_100915633 3300006358 Bacteria 813
35 Ga0097620_100186443 3300006931 Bacteria 2158
36 Ga0105240_10005853 3300009093 Bacteria 18229
37 Ga0105240_10020708 3300009093 Bacteria 8763
38 Ga0105245_10013601 3300009098 Bacteria 7089
39 Ga0105242_10217930 3300009176 Bacteria 1704
40 Ga0105248_10062278 3300009177 Bacteria 4189
41 Ga0105238_10053134 3300009551 Bacteria 4072
42 Ga0105238_10236844 3300009551 Bacteria 1803
43 Ga0105238_10441457 3300009551 Bacteria 1298
44 Ga0105238_11023492 3300009551 Bacteria 847
45 Ga0105246_10123529 3300011119 Bacteria 1922
46 Ga0157370_10601063 3300013104 Bacteria 1007
47 Ga0157369_10050793 3300013105 Bacteria 4488
48 Ga0157369_10140699 3300013105 Bacteria 2553
49 Ga0157374_10428193 3300013296 Bacteria 1323
50 Ga0157378_10039412 3300013297 Bacteria 4190
51 Ga0157378_10187032 3300013297 Bacteria 1951
52 Ga0163162_10226364 3300013306 Bacteria 2000
53 Ga0157372_10182892 3300013307 Unclassified 2427
54 Ga0157372_10909049 3300013307 Bacteria 1021
55 Ga0163161_10635520 3300017792 Bacteria 883
56 Ga0213876_10028634 3300021384 Bacteria 2937
57 Ga0209233_1000119 3300025261 Bacteria 235924
58 Ga0207680_10045727 3300025903 Bacteria 2583
59 Ga0207647_10000178 3300025904 Bacteria 50957
60 Ga0207654_10524556 3300025911 Bacteria 839
61 Ga0207695_10053974 3300025913 Bacteria 4200
62 Ga0207694_10066275 3300025924 Bacteria 2817
63 Ga0207694_10102045 3300025924 Bacteria 2274
64 Ga0207694_10572467 3300025924 Bacteria 949
65 Ga0207694_10926556 3300025924 Bacteria 737
66 Ga0207687_10016037 3300025927 Bacteria 4917
67 Ga0207690_10461754 3300025932 Bacteria 1022
68 Ga0207690_10478288 3300025932 Bacteria 1005
69 Ga0207690_10537456 3300025932 Bacteria 949
70 Ga0207706_10018005 3300025933 Bacteria 6356
71 Ga0207686_10215886 3300025934 Bacteria 1382
72 Ga0207711_10058920 3300025941 Bacteria 3306
73 Ga0207689_10291660 3300025942 Bacteria 1351
74 Ga0207668_10304823 3300025972 Bacteria 1316
75 Ga0207668_11327365 3300025972 Bacteria 648
76 Ga0207640_10044984 3300025981 Bacteria 2832
77 Ga0207640_10587822 3300025981 Bacteria 941
78 Ga0207703_10001155 3300026035 Bacteria 24910
79 Ga0207703_10001220 3300026035 Bacteria 24044
80 Ga0207639_10116622 3300026041 Bacteria 2187
81 Ga0207676_10002807 3300026095 Bacteria 12387
82 Ga0207676_10362808 3300026095 Bacteria 1343
83 Ga0268265_10234861 3300028380 Bacteria 1614
84 Ga0307517_10044963 3300028786 Bacteria 4653
85 Ga0265338_10009752 3300028800 Bacteria 11391
86 Ga0265338_10029873 3300028800 Bacteria 5392
87 Ga0265338_10158929 3300028800 Bacteria 1748
88 Ga0265338_10217681 3300028800 Bacteria 1429
89 Ga0265324_10103635 3300029957 Unclassified 966
90 Ga0265327_10000290 3300031251 Bacteria 98475
91 Ga0265327_10001958 3300031251 Bacteria 23590
92 Ga0265327_10012891 3300031251 Bacteria 5598
93 Ga0307513_10395887 3300031456 Bacteria 1117
94 Ga0307508_10000537 3300031616 Bacteria 45080
95 Ga0307412_10097718 3300031911 Bacteria 2069
96 Ga0307510_10004156 3300033180 Bacteria 16999
97 Ga0373937_0211348 3300036401 Bacteria 1826
98 Ga0373937_0273648 3300036401 Bacteria 1594
99 Ga0316582_0521276 3300036647 Bacteria 819
100 Ga0316584_0116789 3300036712 Unclassified 1995
101 Ga0395899_0139287 3300037312 Bacteria 1727
102 Ga0395900_0156335 3300037418 Bacteria 2329
103 Ga0395900_0368084 3300037418 Bacteria 1407
104 Ga0395898_0884969 3300037466 Bacteria 831
105 Ga0395901_0023000 3300038443 Bacteria 6389
106 Ga0395901_0204138 3300038443 Bacteria 2071
107 Ga0436365_0393398 3300039437 Bacteria 7401
108 Ga0436365_1430082 3300039437 Bacteria 1881
109 Ga0495585_0214074 3300046492 Bacteria 975
110 Ga0495583_0007448 3300046506 Bacteria 6872
111 Ga0495648_0097284 3300046524 Bacteria 1633
112 Ga0495668_0038705 3300046616 Bacteria 2664
113 Ga0495668_0084947 3300046616 Bacteria 1736
114 Ga0495625_0005174 3300046660 Bacteria 12035
115 Ga0495625_0013067 3300046660 Bacteria 6691
116 Ga0495625_0235929 3300046660 Bacteria 1193
117 Ga0495670_0019355 3300046691 Bacteria 3354
118 Ga0495677_0033971 3300047445 Bacteria 1860
119 Ga0495686_0000191 3300047472 Bacteria 114738
120 Ga0495686_0063074 3300047472 Bacteria 2297
121 Ga0495686_0115111 3300047472 Bacteria 1608
122 Ga0496105_0307285 3300048908 Bacteria 1274
123 Ga0496115_0044992 3300048918 Bacteria 3523
124 Ga0501241_010726 3300049758 Bacteria 1664
125 Ga0501267_004501 3300049764 Bacteria 1298
126 Ga0501035_0298479 3300049822 Bacteria 1358
127 nmdc:mga0k408_100143_c1 3300050493 Bacteria 1708
128 nmdc:mga07m45_155470_c1 3300050496 Bacteria 1327
129 Ga0500643_001036 3300053087 Bacteria 16907
130 Ga0500643_015587 3300053087 Bacteria 2601
131 Ga0500641_0078923 3300053096 Bacteria 1395
132 Ga0500650_0107959 3300053098 Bacteria 1300
133 Ga0500642_0000002 3300053130 Bacteria 795093
134 Ga0500658_0006543 3300053134 Bacteria 4320
135 Ga0500559_0013489 3300053136 Bacteria 3461
136 Ga0500559_0056551 3300053136 Bacteria 1741
137 Ga0500616_0013392 3300053153 Bacteria 4763
138 Ga0500616_0080030 3300053153 Bacteria 1644
139 Ga0500645_004827 3300053730 Bacteria 5087
140 2600200366 2599185354 Bacteria 4398675
141 2753763822 2751185897 Bacteria 5322941
142 2885429700 2885429604 Bacteria 3642894
143 2928030914 2928027323 Bacteria 4382488
144 2984557886 2984555340 Bacteria 4247089
145 2984567748 2984564862 Bacteria 4339992
146 2993358800 2993356040 Bacteria 4247105
147 Ga0495625_0000451
148 JGI24739J22299_10005309
149 JGI24737J22298_10005653
150 JGI24735J21928_10001441
151 JGI24738J21930_10000585
152 JGI25165J46597_1000053
153 rootH2_10134643
154 rootL2_10098888
155 Ga0058863_11658733
156 Ga0058862_12369427
157 Ga0065165_1002844
158 Ga0068869_100218946
159 Ga0070666_10536347
160 Ga0070668_100003920
161 Ga0070659_100277069
162 Ga0070662_100160360
163 Ga0068853_100738584
164 Ga0070672_100424672
165 Ga0068855_100544110
166 Ga0070664_100088806
167 Ga0068857_100126115
168 Ga0068854_100403287
169 Ga0068852_100521865
170 Ga0068859_100186441
171 Ga0068864_100003879
172 Ga0068864_100366346
173 Ga0068861_100243152
174 Ga0068858_100000423
175 Ga0068858_100001286
176 Ga0068860_100504638
177 Ga0068862_101001024
178 Ga0075366_10081938
179 Ga0075370_10092241
180 Ga0068871_100915633
181 Ga0097620_100186443
182 Ga0105240_10005853
183 Ga0105240_10020708
184 Ga0105245_10013601
185 Ga0105242_10217930
186 Ga0105248_10062278
187 Ga0105238_10053134
188 Ga0105238_10236844
189 Ga0105238_10441457
190 Ga0105238_11023492
191 Ga0105246_10123529
192 Ga0157370_10601063
193 Ga0157369_10050793
194 Ga0157369_10140699
195 Ga0157374_10428193
196 Ga0157378_10039412
197 Ga0157378_10187032
198 Ga0163162_10226364
199 Ga0157372_10182892
200 Ga0157372_10909049
201 Ga0163161_10635520
202 Ga0213876_10028634
203 Ga0209233_1000119
204 Ga0207680_10045727
205 Ga0207647_10000178
206 Ga0207654_10524556
207 Ga0207695_10053974
208 Ga0207694_10066275
209 Ga0207694_10102045
210 Ga0207694_10572467
211 Ga0207694_10926556
212 Ga0207687_10016037
213 Ga0207690_10461754
214 Ga0207690_10478288
215 Ga0207690_10537456
216 Ga0207706_10018005
217 Ga0207686_10215886
218 Ga0207711_10058920
219 Ga0207689_10291660
220 Ga0207668_10304823
221 Ga0207668_11327365
222 Ga0207640_10044984
223 Ga0207640_10587822
224 Ga0207703_10001155
225 Ga0207703_10001220
226 Ga0207639_10116622
227 Ga0207676_10002807
228 Ga0207676_10362808
229 Ga0268265_10234861
230 Ga0307517_10044963
231 Ga0265338_10009752
232 Ga0265338_10029873
233 Ga0265338_10158929
234 Ga0265338_10217681
235 Ga0265324_10103635
236 Ga0265327_10000290
237 Ga0265327_10001958
238 Ga0265327_10012891
239 Ga0307513_10395887
240 Ga0307508_10000537
241 Ga0307412_10097718
242 Ga0307510_10004156
243 Ga0373937_0211348
244 Ga0373937_0273648
245 Ga0316582_0521276
246 Ga0316584_0116789
247 Ga0395899_0139287
248 Ga0395900_0156335
249 Ga0395900_0368084
250 Ga0395898_0884969
251 Ga0395901_0023000
252 Ga0395901_0204138
253 Ga0436365_0393398
254 Ga0436365_1430082
255 Ga0495585_0214074
256 Ga0495583_0007448
257 Ga0495648_0097284
258 Ga0495668_0038705
259 Ga0495668_0084947
260 Ga0495625_0005174
261 Ga0495625_0013067
262 Ga0495625_0235929
263 Ga0495670_0019355
264 Ga0495677_0033971
265 Ga0495686_0000191
266 Ga0495686_0063074
267 Ga0495686_0115111
268 Ga0496105_0307285
269 Ga0496115_0044992
270 Ga0501241_010726
271 Ga0501267_004501
272 Ga0501035_0298479
273 nmdc:mga0k408_100143_c1
274 nmdc:mga07m45_155470_c1
275 Ga0500643_001036
276 Ga0500643_015587
277 Ga0500641_0078923
278 Ga0500650_0107959
279 Ga0500642_0000002
280 Ga0500658_0006543
281 Ga0500559_0013489
282 Ga0500559_0056551
283 Ga0500616_0013392
284 Ga0500616_0080030
285 Ga0500645_004827
286 2600200366
287 2753763822
288 2885429700
289 2928030914
290 2984557886
291 2984567748
292 2993358800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xxb-assembly1.cif.gz_O large subunit of toxoplasma gondii ribosome 0.6485 73 150
3g4s-assembly1.cif.gz_R co-crystal structure of tiamulin bound to the large ribosomal subunit 0.6302 60 147
6th6-assembly1.cif.gz_BV cryo-em structure of t. kodakarensis 70s ribosome 0.6283 73 150
6cww-assembly1.cif.gz_A cs h-nox mutant with unnatural amino acid 4-cyano-l-phenylalanine at site 5 0.5861 38 148
4v6u-assembly1.cif.gz_BS promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes 0.5835 73 152
ID Description Score Start End Superfamily
af_K7MZM3_401_688_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7985 43 60 2.130.10.10
af_I1M2G3_44_149_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6548 42 147 3.40.50.2000
3u5iP00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.612 73 152 3.90.470.10
3u6yC00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Alba-like domain 0.6063 52 149 3.30.110.20
af_A0A0R0G5W5_110_196_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6011 44 156 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A847REI0-F1-model_v4 deleted 0.8869 42 172
AF-A0A0P7YNW7-F1-model_v4 Uncharacterized protein 0.8689 43 172
AF-A0A5A9ZCE5-F1-model_v4 Uncharacterized protein 0.8516 43 176
AF-A0A239D399-F1-model_v4 Lipoprotein 0.8494 43 172
AF-A0A351PWS4-F1-model_v4 deleted 0.8378 27 172

Map