F198673

General Info

Members Datasets Scaffolds Average Seq Length
146 111 146 135

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0263247|Ga0501032_0263247_315_737
Length 140
Sequence VPLELVSLLVNDYDTGIDFFTGALGFVLAEDTPAMTTDGRPKRWVVVRPQDGGAGLVIARAEGDEQKAAVGNQFAGRVGLFLRVEDVDATLARVQEWGCSMVRPPRDESYGRVCVFRDPWGNLWDLLGAPAKEGEQVPRT

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
36 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
68 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
75 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
76 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.42
Rhizosphere 79.45
Stem 0
Stem Tuber 0
Unclassified 17.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10234370 3300005327 Bacteria 1555
2 Ga0070660_100280771 3300005339 Bacteria 1363
3 Ga0070692_10597413 3300005345 Bacteria 730
4 Ga0070675_100379412 3300005354 Bacteria 1258
5 Ga0070675_101877894 3300005354 Bacteria 552
6 Ga0070674_100396099 3300005356 Bacteria 1127
7 Ga0070674_100537789 3300005356 Bacteria 978
8 Ga0070659_101249308 3300005366 Bacteria 658
9 Ga0070714_100207850 3300005435 Bacteria 1793
10 Ga0070714_102017088 3300005435 Bacteria 563
11 Ga0070678_100164382 3300005456 Bacteria 1801
12 Ga0070681_10498128 3300005458 Bacteria 1131
13 Ga0068867_101376165 3300005459 Bacteria 654
14 Ga0068867_102372319 3300005459 Bacteria 505
15 Ga0070685_10146284 3300005466 Bacteria 1493
16 Ga0070684_100141484 3300005535 Bacteria 2175
17 Ga0070672_100956430 3300005543 Bacteria 758
18 Ga0070665_100576790 3300005548 Bacteria 1138
19 Ga0070702_100331005 3300005615 Bacteria 1065
20 Ga0070702_100736952 3300005615 Bacteria 755
21 Ga0068866_10923814 3300005718 Bacteria 615
22 Ga0068870_10150592 3300005840 Bacteria 1370
23 Ga0068862_102057822 3300005844 Bacteria 582
24 Ga0081539_10001489 3300005985 Bacteria 39599
25 Ga0070717_10009735 3300006028 Bacteria 7234
26 Ga0070717_10016184 3300006028 Bacteria 5778
27 Ga0070717_10405591 3300006028 Bacteria 1225
28 Ga0075428_100318602 3300006844 Bacteria 1671
29 Ga0111539_12096441 3300009094 Bacteria 656
30 Ga0105245_10077827 3300009098 Bacteria 3025
31 Ga0105243_10150660 3300009148 Bacteria 1995
32 Ga0105241_11634405 3300009174 Bacteria 624
33 Ga0105248_11590388 3300009177 Bacteria 740
34 Ga0105237_11084685 3300009545 Bacteria 807
35 Ga0105239_10612558 3300010375 Bacteria 1242
36 Ga0105246_10882677 3300011119 Bacteria 800
37 Ga0105246_11033531 3300011119 Bacteria 746
38 Ga0157369_10775196 3300013105 Bacteria 986
39 Ga0163162_11272899 3300013306 Bacteria 835
40 Ga0157372_11513887 3300013307 Bacteria 773
41 Ga0163163_10089692 3300014325 Bacteria 3087
42 Ga0157380_10258753 3300014326 Bacteria 1580
43 Ga0213873_10044937 3300021358 Bacteria 1150
44 Ga0213874_10009951 3300021377 Bacteria 2368
45 Ga0213874_10227270 3300021377 Bacteria 680
46 Ga0213876_10016708 3300021384 Bacteria 3878
47 Ga0213876_10085369 3300021384 Bacteria 1670
48 Ga0213876_10225315 3300021384 Bacteria 997
49 Ga0213875_10002806 3300021388 Bacteria 10249
50 Ga0213875_10004107 3300021388 Bacteria 8086
51 Ga0213875_10083425 3300021388 Bacteria 1491
52 Ga0207642_10599573 3300025899 Bacteria 685
53 Ga0207688_10071974 3300025901 Bacteria 1964
54 Ga0207643_10388772 3300025908 Bacteria 880
55 Ga0207705_10493381 3300025909 Bacteria 951
56 Ga0207660_10983602 3300025917 Unclassified 688
57 Ga0207652_10154928 3300025921 Unclassified 2052
58 Ga0207659_10272042 3300025926 Bacteria 1382
59 Ga0207664_10003562 3300025929 Bacteria 10403
60 Ga0207664_10450383 3300025929 Bacteria 1149
61 Ga0207664_10812412 3300025929 Bacteria 841
62 Ga0207709_10119914 3300025935 Bacteria 1774
63 Ga0207669_10672037 3300025937 Bacteria 849
64 Ga0207669_10938691 3300025937 Bacteria 724
65 Ga0207704_11532549 3300025938 Bacteria 572
66 Ga0207691_10982345 3300025940 Bacteria 705
67 Ga0207667_11787242 3300025949 Unclassified 579
68 Ga0207651_11233803 3300025960 Bacteria 672
69 Ga0207640_10904320 3300025981 Bacteria 771
70 Ga0207677_10236493 3300026023 Bacteria 1475
71 Ga0207677_10390091 3300026023 Bacteria 1178
72 Ga0207708_10289876 3300026075 Bacteria 1328
73 Ga0207648_11056315 3300026089 Bacteria 761
74 Ga0207675_100695561 3300026118 Bacteria 1025
75 Ga0268266_10281748 3300028379 Bacteria 1546
76 Ga0268265_11091251 3300028380 Bacteria 792
77 Ga0268264_11016967 3300028381 Bacteria 836
78 Ga0265319_1085593 3300028563 Bacteria 998
79 Ga0265318_10042618 3300028577 Bacteria 1722
80 Ga0265320_10297617 3300031240 Bacteria 714
81 Ga0307409_100048403 3300031995 Bacteria 3235
82 Ga0307409_101022144 3300031995 Bacteria 845
83 Ga0307409_102105931 3300031995 Bacteria 594
84 Ga0307416_103699585 3300032002 Bacteria 512
85 Ga0307415_101561756 3300032126 Bacteria 633
86 Ga0307507_10418012 3300033179 Unclassified 754
87 Ga0373936_0000002 3300035113 Bacteria 452874
88 Ga0395905_1682819 3300037471 Bacteria 540
89 Ga0436364_0028581 3300037853 Bacteria 23989
90 Ga0436364_0317559 3300037853 Bacteria 1156
91 Ga0436364_0354539 3300037853 Bacteria 726
92 Ga0436364_0357913 3300037853 Bacteria 2899
93 Ga0436364_0545370 3300037853 Bacteria 1052
94 Ga0436364_1215864 3300037853 Bacteria 4881
95 Ga0436364_1492754 3300037853 Unclassified 710
96 Ga0436365_0405216 3300039437 Bacteria 523
97 Ga0436365_0813046 3300039437 Bacteria 620
98 Ga0436365_0855306 3300039437 Bacteria 4267
99 Ga0436365_0955152 3300039437 Bacteria 6849
100 Ga0436365_1771882 3300039437 Bacteria 23940
101 Ga0436363_1054917 3300039450 Bacteria 1895
102 Ga0436363_1276895 3300039450 Bacteria 8446
103 Ga0436363_1376647 3300039450 Bacteria 2191
104 Ga0436362_0058200 3300039453 Bacteria 2644
105 Ga0439463_160390 3300042016 Bacteria 583
106 Ga0439458_0059308 3300042157 Bacteria 953
107 Ga0439464_0027970 3300042439 Bacteria 1570
108 Ga0466963_1037124 3300044694 Unclassified 577
109 Ga0466968_0033282 3300044735 Bacteria 2148
110 Ga0466970_0165697 3300044765 Unclassified 1223
111 Ga0466959_0040022 3300045049 Bacteria 3464
112 Ga0466959_0110152 3300045049 Bacteria 1966
113 Ga0466958_0001464 3300045836 Bacteria 11232
114 Ga0466967_0015140 3300045976 Bacteria 6037
115 Ga0466967_0231439 3300045976 Bacteria 1760
116 Ga0466967_0637740 3300045976 Bacteria 1053
117 Ga0495664_0293704 3300046477 Bacteria 981
118 Ga0495608_0276135 3300046511 Bacteria 1044
119 Ga0495630_0281086 3300046517 Bacteria 1271
120 Ga0495652_0078400 3300046529 Bacteria 2735
121 Ga0495640_0339751 3300046533 Bacteria 928
122 Ga0495645_0183853 3300046543 Bacteria 1430
123 Ga0495656_0315599 3300046615 Unclassified 804
124 Ga0495634_0498061 3300046642 Bacteria 714
125 Ga0495635_0409832 3300046663 Bacteria 899
126 Ga0495657_0319581 3300046675 Bacteria 923
127 Ga0495674_0259209 3300047319 Bacteria 1429
128 Ga0495680_0908840 3300047322 Bacteria 568
129 Ga0496103_0632164 3300048906 Bacteria 681
130 Ga0496109_0846420 3300048912 Bacteria 852
131 Ga0496110_1011118 3300048913 Bacteria 739
132 Ga0496111_0781507 3300048914 Unclassified 692
133 Ga0496114_0128321 3300048917 Bacteria 2188
134 Ga0496119_0018251 3300048922 Bacteria 5237
135 Ga0501032_0263247 3300049569 Bacteria 1118
136 Ga0501036_0354218 3300049572 Bacteria 1226
137 Ga0501036_0681741 3300049572 Bacteria 850
138 Ga0501038_0469347 3300049574 Bacteria 966
139 Ga0501040_0341439 3300049576 Bacteria 1072
140 Ga0501046_0019566 3300049580 Bacteria 5613
141 Ga0501047_0207331 3300049581 Bacteria 1819
142 Ga0501048_0007769 3300049582 Bacteria 8132
143 Ga0501070_0521002 3300049586 Bacteria 954
144 Ga0501080_0273209 3300049742 Bacteria 1538
145 Ga0501035_0209516 3300049822 Bacteria 1668
146 Ga0501044_0753839 3300049823 Bacteria 855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0128321 Ga0496114_0128321_1768_2145 125
2 3300005615 Ga0070702_100736952 Ga0070702_1007369522 128
3 3300005718 Ga0068866_10923814 Ga0068866_109238142 128
4 3300009094 Ga0111539_12096441 Ga0111539_120964412 128
5 3300025899 Ga0207642_10599573 Ga0207642_105995732 128
6 3300031995 Ga0307409_102105931 Ga0307409_1021059312 128
7 3300049822 Ga0501035_0209516 Ga0501035_0209516_111_497 128
8 3300031995 Ga0307409_101022144 Ga0307409_1010221442 129
9 3300005345 Ga0070692_10597413 Ga0070692_105974131 130
10 3300005356 Ga0070674_100396099 Ga0070674_1003960992 130
11 3300005458 Ga0070681_10498128 Ga0070681_104981282 130
12 3300005543 Ga0070672_100956430 Ga0070672_1009564301 130
13 3300005548 Ga0070665_100576790 Ga0070665_1005767902 130
14 3300005615 Ga0070702_100331005 Ga0070702_1003310051 130
15 3300005840 Ga0068870_10150592 Ga0068870_101505924 130
16 3300005844 Ga0068862_102057822 Ga0068862_1020578221 130
17 3300006844 Ga0075428_100318602 Ga0075428_1003186022 130
18 3300011119 Ga0105246_11033531 Ga0105246_110335311 130
19 3300013306 Ga0163162_11272899 Ga0163162_112728992 130
20 3300014326 Ga0157380_10258753 Ga0157380_102587531 130
21 3300025908 Ga0207643_10388772 Ga0207643_103887722 130
22 3300025917 Ga0207660_10983602 Ga0207660_109836022 130
23 3300025921 Ga0207652_10154928 Ga0207652_101549282 130
24 3300025937 Ga0207669_10938691 Ga0207669_109386911 130
25 3300025938 Ga0207704_11532549 Ga0207704_115325491 130
26 3300025940 Ga0207691_10982345 Ga0207691_109823451 130
27 3300025949 Ga0207667_11787242 Ga0207667_117872422 130
28 3300026118 Ga0207675_100695561 Ga0207675_1006955611 130
29 3300028379 Ga0268266_10281748 Ga0268266_102817483 130
30 3300028380 Ga0268265_11091251 Ga0268265_110912512 130
31 3300028563 Ga0265319_1085593 Ga0265319_10855932 130
32 3300028577 Ga0265318_10042618 Ga0265318_100426184 130
33 3300031240 Ga0265320_10297617 Ga0265320_102976172 130
34 3300035113 Ga0373936_0000002 Ga0373936_0000002_383163_383558 130
35 3300039437 Ga0436365_0405216 Ga0436365_0405216_55_453 130
36 3300046615 Ga0495656_0315599 Ga0495656_0315599_101_493 130
37 3300046675 Ga0495657_0319581 Ga0495657_0319581_506_898 130
38 3300005339 Ga0070660_100280771 Ga0070660_1002807712 131
39 3300005354 Ga0070675_101877894 Ga0070675_1018778942 131
40 3300005356 Ga0070674_100537789 Ga0070674_1005377892 131
41 3300005366 Ga0070659_101249308 Ga0070659_1012493081 131
42 3300005435 Ga0070714_100207850 Ga0070714_1002078503 131
43 3300005435 Ga0070714_102017088 Ga0070714_1020170881 131
44 3300005456 Ga0070678_100164382 Ga0070678_1001643823 131
45 3300005459 Ga0068867_101376165 Ga0068867_1013761652 131
46 3300005535 Ga0070684_100141484 Ga0070684_1001414843 131
47 3300006028 Ga0070717_10016184 Ga0070717_100161842 131
48 3300009098 Ga0105245_10077827 Ga0105245_100778274 131
49 3300009148 Ga0105243_10150660 Ga0105243_101506602 131
50 3300010375 Ga0105239_10612558 Ga0105239_106125582 131
51 3300011119 Ga0105246_10882677 Ga0105246_108826772 131
52 3300025901 Ga0207688_10071974 Ga0207688_100719743 131
53 3300025926 Ga0207659_10272042 Ga0207659_102720422 131
54 3300025929 Ga0207664_10003562 Ga0207664_100035626 131
55 3300025929 Ga0207664_10450383 Ga0207664_104503832 131
56 3300025935 Ga0207709_10119914 Ga0207709_101199142 131
57 3300025937 Ga0207669_10672037 Ga0207669_106720373 131
58 3300025960 Ga0207651_11233803 Ga0207651_112338032 131
59 3300025981 Ga0207640_10904320 Ga0207640_109043202 131
60 3300026023 Ga0207677_10390091 Ga0207677_103900912 131
61 3300031995 Ga0307409_100048403 Ga0307409_1000484033 131
62 3300032002 Ga0307416_103699585 Ga0307416_1036995851 131
63 3300032126 Ga0307415_101561756 Ga0307415_1015617562 131
64 3300037853 Ga0436364_0317559 Ga0436364_0317559_52_447 131
65 3300042016 Ga0439463_160390 Ga0439463_160390_175_570 131
66 3300042157 Ga0439458_0059308 Ga0439458_0059308_473_868 131
67 3300042439 Ga0439464_0027970 Ga0439464_0027970_592_987 131
68 3300045976 Ga0466967_0231439 Ga0466967_0231439_844_1242 131
69 3300046543 Ga0495645_0183853 Ga0495645_0183853_152_547 131
70 3300048906 Ga0496103_0632164 Ga0496103_0632164_205_600 131
71 3300048913 Ga0496110_1011118 Ga0496110_1011118_68_472 131
72 3300048914 Ga0496111_0781507 Ga0496111_0781507_52_447 131
73 3300021384 Ga0213876_10085369 Ga0213876_100853693 132
74 3300039437 Ga0436365_0955152 Ga0436365_0955152_5452_5850 132
75 3300048922 Ga0496119_0018251 Ga0496119_0018251_3640_4077 132
76 3300005459 Ga0068867_102372319 Ga0068867_1023723191 133
77 3300009174 Ga0105241_11634405 Ga0105241_116344052 133
78 3300013307 Ga0157372_11513887 Ga0157372_115138871 133
79 3300033179 Ga0307507_10418012 Ga0307507_104180122 133
80 3300046477 Ga0495664_0293704 Ga0495664_0293704_131_532 133
81 3300046511 Ga0495608_0276135 Ga0495608_0276135_479_880 133
82 3300046517 Ga0495630_0281086 Ga0495630_0281086_412_813 133
83 3300046533 Ga0495640_0339751 Ga0495640_0339751_63_464 133
84 3300046642 Ga0495634_0498061 Ga0495634_0498061_62_463 133
85 3300046663 Ga0495635_0409832 Ga0495635_0409832_154_555 133
86 3300047319 Ga0495674_0259209 Ga0495674_0259209_137_538 133
87 3300047322 Ga0495680_0908840 Ga0495680_0908840_57_458 133
88 3300006028 Ga0070717_10405591 Ga0070717_104055912 134
89 3300013105 Ga0157369_10775196 Ga0157369_107751961 134
90 3300025929 Ga0207664_10812412 Ga0207664_108124122 134
91 3300045976 Ga0466967_0637740 Ga0466967_0637740_494_898 134
92 3300005985 Ga0081539_10001489 Ga0081539_1000148935 135
93 3300009177 Ga0105248_11590388 Ga0105248_115903882 135
94 3300021358 Ga0213873_10044937 Ga0213873_100449372 135
95 3300021377 Ga0213874_10009951 Ga0213874_100099513 135
96 3300021377 Ga0213874_10227270 Ga0213874_102272702 135
97 3300021384 Ga0213876_10016708 Ga0213876_100167084 135
98 3300021384 Ga0213876_10225315 Ga0213876_102253152 135
99 3300021388 Ga0213875_10002806 Ga0213875_1000280612 135
100 3300037853 Ga0436364_0028581 Ga0436364_0028581_11614_12096 135
101 3300037853 Ga0436364_0545370 Ga0436364_0545370_115_522 135
102 3300037853 Ga0436364_1492754 Ga0436364_1492754_94_501 135
103 3300039437 Ga0436365_0855306 Ga0436365_0855306_2047_2454 135
104 3300039437 Ga0436365_1771882 Ga0436365_1771882_16651_17064 135
105 3300039450 Ga0436363_1054917 Ga0436363_1054917_1393_1800 135
106 3300039450 Ga0436363_1276895 Ga0436363_1276895_3264_3677 135
107 3300039450 Ga0436363_1376647 Ga0436363_1376647_1182_1589 135
108 3300039453 Ga0436362_0058200 Ga0436362_0058200_1961_2374 135
109 3300044735 Ga0466968_0033282 Ga0466968_0033282_1498_1905 135
110 3300045049 Ga0466959_0110152 Ga0466959_0110152_1275_1682 135
111 3300049572 Ga0501036_0681741 Ga0501036_0681741_286_693 135
112 3300049576 Ga0501040_0341439 Ga0501040_0341439_579_986 135
113 3300005354 Ga0070675_100379412 Ga0070675_1003794122 136
114 3300009545 Ga0105237_11084685 Ga0105237_110846852 136
115 3300026023 Ga0207677_10236493 Ga0207677_102364931 136
116 3300026075 Ga0207708_10289876 Ga0207708_102898762 136
117 3300026089 Ga0207648_11056315 Ga0207648_110563151 136
118 3300028381 Ga0268264_11016967 Ga0268264_110169671 136
119 3300037471 Ga0395905_1682819 Ga0395905_1682819_113_526 137
120 3300039437 Ga0436365_0813046 Ga0436365_0813046_137_559 140
121 3300044694 Ga0466963_1037124 Ga0466963_1037124_25_447 140
122 3300049569 Ga0501032_0263247 Ga0501032_0263247_315_737 140
123 3300049572 Ga0501036_0354218 Ga0501036_0354218_543_965 140
124 3300049574 Ga0501038_0469347 Ga0501038_0469347_52_474 140
125 3300049580 Ga0501046_0019566 Ga0501046_0019566_5059_5481 140
126 3300049581 Ga0501047_0207331 Ga0501047_0207331_748_1170 140
127 3300049582 Ga0501048_0007769 Ga0501048_0007769_4154_4576 140
128 3300049586 Ga0501070_0521002 Ga0501070_0521002_291_713 140
129 3300049742 Ga0501080_0273209 Ga0501080_0273209_733_1155 140
130 3300049823 Ga0501044_0753839 Ga0501044_0753839_303_725 140
131 3300021388 Ga0213875_10083425 Ga0213875_100834252 141
132 3300046529 Ga0495652_0078400 Ga0495652_0078400_388_819 142
133 3300005327 Ga0070658_10234370 Ga0070658_102343701 143
134 3300005466 Ga0070685_10146284 Ga0070685_101462843 143
135 3300006028 Ga0070717_10009735 Ga0070717_100097358 143
136 3300014325 Ga0163163_10089692 Ga0163163_100896921 143
137 3300021388 Ga0213875_10004107 Ga0213875_100041078 143
138 3300025909 Ga0207705_10493381 Ga0207705_104933812 143
139 3300037853 Ga0436364_0354539 Ga0436364_0354539_91_546 143
140 3300037853 Ga0436364_0357913 Ga0436364_0357913_383_814 143
141 3300037853 Ga0436364_1215864 Ga0436364_1215864_1690_2145 143
142 3300044765 Ga0466970_0165697 Ga0466970_0165697_485_943 143
143 3300045049 Ga0466959_0040022 Ga0466959_0040022_716_1174 143
144 3300045836 Ga0466958_0001464 Ga0466958_0001464_5530_5988 143
145 3300045976 Ga0466967_0015140 Ga0466967_0015140_4218_4676 143
146 3300048912 Ga0496109_0846420 Ga0496109_0846420_406_837 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

3

126

0.91

PF18029

Glyoxalase_6

Glyoxalase-like domain

6

127

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.85 1 130
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8292 1 133
5wew-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae fosfomycin resistance protein (fosakp) with inhibitor (any1) bound 0.8195 1 132
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.8188 1 133
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8169 1 133
ID Description Score Start End Superfamily
5wewB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8196 1 132 3.10.180.10
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8182 5 134 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8136 2 128 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8132 79 133 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8124 80 128 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6I3C4K0-F1-model_v4 VOC family protein 0.9895 1 129
AF-A0A6J6WIX9-F1-model_v4 Unannotated protein 0.9878 1 129
AF-A0A2V8FCE2-F1-model_v4 Extradiol dioxygenase 0.9827 18 131 GO:0051213
AF-A0A6I3C4K0-F1-model_v4 VOC family protein 0.9818 1 129
AF-A0A1C6S711-F1-model_v4 Catechol 2,3-dioxygenase 0.9779 1 129 GO:0051213

Feature Viewer

pLDDT pTM Quality
89.26 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map