F199779

General Info

Members Datasets Scaffolds Average Seq Length
147 111 294 177

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100039421|Ga0070684_1000394215
Length 189
Sequence MSALAVAPAPPIQDPRLAGDVLAHLEAQLQSTQRLLHSVLAQGVAIRAQDVDGVVRQVAAFQAELERRARLEEDRARLLARAGAQLGTAPHAVTLSQLSALMTPHDAALATARSAELQGLLAELQREHACNQALMRQELAFLDHLLRLVGAGGMGPGDAGAYTANGIRPAAHMPHTTVRTGPRALDLQA

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 17.69
Rhizosphere 80.27
Stem 0
Stem Tuber 0
Unclassified 8.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100039421 3300005535 Bacteria 4063
2 Ga0070683_100353895 3300005329 Bacteria 1398
3 Ga0070660_100042215 3300005339 Bacteria 3480
4 Ga0070692_10017073 3300005345 Bacteria 3463
5 Ga0070669_100367540 3300005353 Bacteria 1171
6 Ga0070659_100000002 3300005366 Bacteria 369239
7 Ga0070714_100000087 3300005435 Bacteria 78107
8 Ga0070714_100052744 3300005435 Bacteria 3470
9 Ga0070714_100127937 3300005435 Bacteria 2267
10 Ga0070710_10000007 3300005437 Bacteria 215320
11 Ga0070701_10374214 3300005438 Bacteria 896
12 Ga0070694_100274105 3300005444 Bacteria 1284
13 Ga0068867_101560765 3300005459 Bacteria 616
14 Ga0070679_100348396 3300005530 Bacteria 1429
15 Ga0070684_100302756 3300005535 Bacteria 1467
16 Ga0070672_101021134 3300005543 Bacteria 733
17 Ga0068855_100514211 3300005563 Bacteria 1300
18 Ga0068854_100653346 3300005578 Bacteria 903
19 Ga0068856_100018797 3300005614 Bacteria 6701
20 Ga0070702_100147544 3300005615 Bacteria 1506
21 Ga0068864_100746373 3300005618 Bacteria 959
22 Ga0068862_101257703 3300005844 Bacteria 740
23 Ga0081455_10021844 3300005937 Bacteria 5994
24 Ga0081455_10392122 3300005937 Bacteria 966
25 Ga0081540_1000626 3300005983 Bacteria 33632
26 Ga0081539_10003784 3300005985 Bacteria 17870
27 Ga0070717_10000024 3300006028 Bacteria 158890
28 Ga0070717_10018080 3300006028 Bacteria 5499
29 Ga0070715_10449387 3300006163 Bacteria 727
30 Ga0070712_100000072 3300006175 Bacteria 51993
31 Ga0075431_100520664 3300006847 Bacteria 1179
32 Ga0075429_100008073 3300006880 Bacteria 9150
33 Ga0105245_10357521 3300009098 Unclassified 1449
34 Ga0105245_11453680 3300009098 Bacteria 736
35 Ga0105243_10499783 3300009148 Bacteria 1152
36 Ga0105239_10045969 3300010375 Bacteria 4784
37 Ga0105239_12578011 3300010375 Unclassified 593
38 Ga0105246_10081392 3300011119 Bacteria 2308
39 Ga0157378_11039546 3300013297 Bacteria 854
40 Ga0157372_10549212 3300013307 Bacteria 1347
41 Ga0163163_10406165 3300014325 Bacteria 1420
42 Ga0213876_10115361 3300021384 Bacteria 1425
43 Ga0207692_10000001 3300025898 Bacteria 558345
44 Ga0207688_10115146 3300025901 Bacteria 1564
45 Ga0207695_10128268 3300025913 Bacteria 2496
46 Ga0207693_10000001 3300025915 Bacteria 469535
47 Ga0207657_10093030 3300025919 Bacteria 2512
48 Ga0207657_10418320 3300025919 Bacteria 1054
49 Ga0207649_10193495 3300025920 Bacteria 1432
50 Ga0207652_10446745 3300025921 Bacteria 1165
51 Ga0207681_10080187 3300025923 Bacteria 2302
52 Ga0207687_10138663 3300025927 Unclassified 1842
53 Ga0207664_10000008 3300025929 Bacteria 309301
54 Ga0207664_10025446 3300025929 Bacteria 4459
55 Ga0207664_10046003 3300025929 Bacteria 3425
56 Ga0207644_10285255 3300025931 Bacteria 1327
57 Ga0207690_10000024 3300025932 Bacteria 194416
58 Ga0207706_10624854 3300025933 Bacteria 924
59 Ga0207670_10712964 3300025936 Bacteria 831
60 Ga0207689_10242035 3300025942 Bacteria 1491
61 Ga0207667_10601872 3300025949 Bacteria 1108
62 Ga0207668_10187940 3300025972 Bacteria 1635
63 Ga0207708_10362943 3300026075 Bacteria 1191
64 Ga0207702_10203113 3300026078 Unclassified 1838
65 Ga0207648_10427612 3300026089 Bacteria 1203
66 Ga0207675_100275839 3300026118 Bacteria 1633
67 Ga0268265_10746800 3300028380 Bacteria 949
68 Ga0265326_10000004 3300028558 Bacteria 283947
69 Ga0265319_1000069 3300028563 Bacteria 82640
70 Ga0265319_1000641 3300028563 Bacteria 23071
71 Ga0265334_10000512 3300028573 Bacteria 19858
72 Ga0265318_10106022 3300028577 Unclassified 1034
73 Ga0265336_10004286 3300028666 Bacteria 5422
74 Ga0265338_10004903 3300028800 Bacteria 17808
75 Ga0265324_10001762 3300029957 Bacteria 11877
76 Ga0265320_10140508 3300031240 Bacteria 1094
77 Ga0265314_10274676 3300031711 Bacteria 956
78 Ga0307413_10005585 3300031824 Bacteria 5634
79 Ga0307410_10190951 3300031852 Unclassified 1557
80 Ga0307410_10251510 3300031852 Unclassified 1374
81 Ga0307406_10959221 3300031901 Bacteria 731
82 Ga0307407_10099655 3300031903 Bacteria 1800
83 Ga0307407_10286794 3300031903 Unclassified 1142
84 Ga0307416_100259553 3300032002 Bacteria 1697
85 Ga0307416_100691146 3300032002 Unclassified 1108
86 Ga0307411_10223007 3300032005 Bacteria 1464
87 Ga0373936_0232841 3300035113 Bacteria 820
88 Ga0373946_0076961 3300035171 Bacteria 1453
89 Ga0373935_0093127 3300035692 Unclassified 1976
90 Ga0395900_0018531 3300037418 Bacteria 7099
91 Ga0395900_0855241 3300037418 Bacteria 835
92 Ga0395898_0000490 3300037466 Bacteria 78132
93 Ga0395898_0097117 3300037466 Bacteria 2830
94 Ga0436364_0561556 3300037853 Bacteria 1259
95 Ga0395901_0484767 3300038443 Bacteria 1261
96 Ga0395901_1390305 3300038443 Bacteria 661
97 Ga0436365_1715172 3300039437 Bacteria 9316
98 Ga0466966_0105904 3300044684 Bacteria 1736
99 Ga0466966_0128633 3300044684 Bacteria 1552
100 Ga0466961_0086850 3300044693 Bacteria 1977
101 Ga0466961_0595464 3300044693 Bacteria 665
102 Ga0466960_0355818 3300044901 Bacteria 836
103 Ga0466959_0028590 3300045049 Bacteria 4134
104 Ga0466959_0082003 3300045049 Bacteria 2324
105 Ga0466959_0118929 3300045049 Bacteria 1880
106 Ga0466958_0117251 3300045836 Bacteria 1665
107 Ga0466958_0274266 3300045836 Unclassified 1080
108 Ga0466958_0282892 3300045836 Bacteria 1063
109 Ga0466958_0290495 3300045836 Bacteria 1049
110 Ga0466958_0458187 3300045836 Bacteria 826
111 Ga0495603_0070213 3300046455 Bacteria 2059
112 Ga0495590_0027963 3300046457 Bacteria 1978
113 Ga0495639_0161077 3300046475 Bacteria 1086
114 Ga0495584_0066224 3300046491 Bacteria 1817
115 Ga0495589_0103662 3300046794 Bacteria 1375
116 Ga0495581_0086288 3300047315 Bacteria 1820
117 Ga0495672_0011374 3300047320 Bacteria 6287
118 Ga0496100_0009852 3300048903 Bacteria 5385
119 Ga0496101_0004711 3300048904 Bacteria 8638
120 Ga0496101_0055196 3300048904 Bacteria 2869
121 Ga0496101_0413832 3300048904 Unclassified 1062
122 Ga0496102_0018486 3300048905 Bacteria 6126
123 Ga0496103_0221029 3300048906 Bacteria 1218
124 Ga0496104_0011251 3300048907 Bacteria 8008
125 Ga0496104_0074228 3300048907 Bacteria 3238
126 Ga0496106_0216741 3300048909 Bacteria 1526
127 Ga0496107_0025955 3300048910 Bacteria 4152
128 Ga0496108_0004312 3300048911 Bacteria 11440
129 Ga0496108_0118075 3300048911 Bacteria 2273
130 Ga0496108_0499874 3300048911 Bacteria 1062
131 Ga0496109_0057111 3300048912 Bacteria 3561
132 Ga0496109_0123270 3300048912 Bacteria 2415
133 Ga0496110_0018253 3300048913 Bacteria 5880
134 Ga0496110_0061501 3300048913 Bacteria 3314
135 Ga0496111_0008020 3300048914 Bacteria 6965
136 Ga0496112_0004385 3300048915 Bacteria 11940
137 Ga0496112_0017072 3300048915 Bacteria 6814
138 Ga0496112_0090153 3300048915 Bacteria 3035
139 Ga0496113_0010071 3300048916 Bacteria 6235
140 Ga0496113_0011269 3300048916 Bacteria 5955
141 Ga0496114_0341645 3300048917 Bacteria 1324
142 Ga0496115_0431851 3300048918 Bacteria 1066
143 Ga0496115_0586906 3300048918 Bacteria 887
144 Ga0501072_0246765 3300049588 Bacteria 1422
145 nmdc:mga09592_3659_c1 3300050508 Bacteria 12395
146 nmdc:mga0a205_841263_c1 3300050515 Bacteria 765
147 Ga0501084_0724912 3300054114 Bacteria 838
148 Ga0070684_100039421
149 Ga0070683_100353895
150 Ga0070660_100042215
151 Ga0070692_10017073
152 Ga0070669_100367540
153 Ga0070659_100000002
154 Ga0070714_100000087
155 Ga0070714_100052744
156 Ga0070714_100127937
157 Ga0070710_10000007
158 Ga0070701_10374214
159 Ga0070694_100274105
160 Ga0068867_101560765
161 Ga0070679_100348396
162 Ga0070684_100302756
163 Ga0070672_101021134
164 Ga0068855_100514211
165 Ga0068854_100653346
166 Ga0068856_100018797
167 Ga0070702_100147544
168 Ga0068864_100746373
169 Ga0068862_101257703
170 Ga0081455_10021844
171 Ga0081455_10392122
172 Ga0081540_1000626
173 Ga0081539_10003784
174 Ga0070717_10000024
175 Ga0070717_10018080
176 Ga0070715_10449387
177 Ga0070712_100000072
178 Ga0075431_100520664
179 Ga0075429_100008073
180 Ga0105245_10357521
181 Ga0105245_11453680
182 Ga0105243_10499783
183 Ga0105239_10045969
184 Ga0105239_12578011
185 Ga0105246_10081392
186 Ga0157378_11039546
187 Ga0157372_10549212
188 Ga0163163_10406165
189 Ga0213876_10115361
190 Ga0207692_10000001
191 Ga0207688_10115146
192 Ga0207695_10128268
193 Ga0207693_10000001
194 Ga0207657_10093030
195 Ga0207657_10418320
196 Ga0207649_10193495
197 Ga0207652_10446745
198 Ga0207681_10080187
199 Ga0207687_10138663
200 Ga0207664_10000008
201 Ga0207664_10025446
202 Ga0207664_10046003
203 Ga0207644_10285255
204 Ga0207690_10000024
205 Ga0207706_10624854
206 Ga0207670_10712964
207 Ga0207689_10242035
208 Ga0207667_10601872
209 Ga0207668_10187940
210 Ga0207708_10362943
211 Ga0207702_10203113
212 Ga0207648_10427612
213 Ga0207675_100275839
214 Ga0268265_10746800
215 Ga0265326_10000004
216 Ga0265319_1000069
217 Ga0265319_1000641
218 Ga0265334_10000512
219 Ga0265318_10106022
220 Ga0265336_10004286
221 Ga0265338_10004903
222 Ga0265324_10001762
223 Ga0265320_10140508
224 Ga0265314_10274676
225 Ga0307413_10005585
226 Ga0307410_10190951
227 Ga0307410_10251510
228 Ga0307406_10959221
229 Ga0307407_10099655
230 Ga0307407_10286794
231 Ga0307416_100259553
232 Ga0307416_100691146
233 Ga0307411_10223007
234 Ga0373936_0232841
235 Ga0373946_0076961
236 Ga0373935_0093127
237 Ga0395900_0018531
238 Ga0395900_0855241
239 Ga0395898_0000490
240 Ga0395898_0097117
241 Ga0436364_0561556
242 Ga0395901_0484767
243 Ga0395901_1390305
244 Ga0436365_1715172
245 Ga0466966_0105904
246 Ga0466966_0128633
247 Ga0466961_0086850
248 Ga0466961_0595464
249 Ga0466960_0355818
250 Ga0466959_0028590
251 Ga0466959_0082003
252 Ga0466959_0118929
253 Ga0466958_0117251
254 Ga0466958_0274266
255 Ga0466958_0282892
256 Ga0466958_0290495
257 Ga0466958_0458187
258 Ga0495603_0070213
259 Ga0495590_0027963
260 Ga0495639_0161077
261 Ga0495584_0066224
262 Ga0495589_0103662
263 Ga0495581_0086288
264 Ga0495672_0011374
265 Ga0496100_0009852
266 Ga0496101_0004711
267 Ga0496101_0055196
268 Ga0496101_0413832
269 Ga0496102_0018486
270 Ga0496103_0221029
271 Ga0496104_0011251
272 Ga0496104_0074228
273 Ga0496106_0216741
274 Ga0496107_0025955
275 Ga0496108_0004312
276 Ga0496108_0118075
277 Ga0496108_0499874
278 Ga0496109_0057111
279 Ga0496109_0123270
280 Ga0496110_0018253
281 Ga0496110_0061501
282 Ga0496111_0008020
283 Ga0496112_0004385
284 Ga0496112_0017072
285 Ga0496112_0090153
286 Ga0496113_0010071
287 Ga0496113_0011269
288 Ga0496114_0341645
289 Ga0496115_0431851
290 Ga0496115_0586906
291 Ga0501072_0246765
292 nmdc:mga09592_3659_c1
293 nmdc:mga0a205_841263_c1
294 Ga0501084_0724912

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05130

FlgN

FlgN protein

17

169

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fup-assembly1.cif.gz_A crystal structure of a putative flagella synthesis protein flgn (pa3352) from pseudomonas aeruginosa at 1.48 a resolution 0.7673 9 135
2fup-assembly1.cif.gz_A crystal structure of a putative flagella synthesis protein flgn (pa3352) from pseudomonas aeruginosa at 1.48 a resolution 0.7101 9 135
3h3m-assembly1.cif.gz_A crystal structure of flagellar protein flit from bordetella bronchiseptica 0.6616 18 142
3k1s-assembly1.cif.gz_A crystal structure of the pts cellobiose specific enzyme iia from bacillus anthracis 0.6534 15 135
3h3m-assembly1.cif.gz_A crystal structure of flagellar protein flit from bordetella bronchiseptica 0.6394 18 142
ID Description Score Start End Superfamily
af_Q8LA67_1_303_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8546 13 79 1.25.10.10
4zxlA03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Hyaluronidase post-catalytic domain-like 0.6757 13 63 1.20.58.460
af_K7M812_36_117_1.10.287.130 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.6474 15 71 1.10.287.130
af_O94651_10_125_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.647 16 141 1.20.58.70
af_P39926_34_229_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6463 15 152 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A653A3C3-F1-model_v4 Uncharacterized protein 0.9624 14 146 GO:0044780
AF-A0A2E5YLQ8-F1-model_v4 DUF222 domain-containing protein 0.9472 9 147
AF-A0A2M7AKC0-F1-model_v4 Flagellar protein FlgN 0.9439 9 141 GO:0044780
AF-A0A1M6AQ27-F1-model_v4 FlgN protein 0.9413 14 146 GO:0044780
AF-A0A5N8Z4T5-F1-model_v4 Flagellar protein FlgN 0.94 14 147 GO:0044780

Map