F200338

General Info

Members Datasets Scaffolds Average Seq Length
147 110 294 193

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10043518|Ga0157371_100435183
Length 220
Sequence MKRKKIIKTNHRLLNLLMQTDDWEMETIDIKTHHKGLDPHRWVSNYADYLYTFAVFRVNDEELAQDLVQETFLAALQRVEKFEGRCTEKTWLTAILKNKIIDVYRSKSSGLAKGAVAPAPEDGDTDFFDHDDGHWNDAHRPARLGIEQPDALENKEFQKILQACMKKLPALWLSVFTMKHVDEEATDVICRELKVTSSNFWVIIHRAKVNLRSCLQRNWI

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
61 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
62 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
63 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
64 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
69 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
70 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
75 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
78 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
79 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
80 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
81 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
82 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
97 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
98 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
99 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
100 2738541283 Pedobacter sp. OK701 Isolate Unclassified
101 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
102 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
103 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
104 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
105 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
106 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
107 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
108 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
109 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
110 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.84
Metatranscriptomes 0
Isolates 8.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.48
Nodule 0
Rhizoplane 0.68
Rhizosphere 80.27
Stem 0
Stem Tuber 0
Unclassified 6.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10043518 3300013102 Bacteria 3198
2 JGI24735J21928_10000084 3300002067 Bacteria 35383
3 JGI25162J39368_1000016 3300002737 Bacteria 288734
4 rootH1_10017112 3300003316 Bacteria 7390
5 rootH2_10215592 3300003320 Bacteria 2312
6 rootL2_10140154 3300003322 Bacteria 5499
7 rootH1_10015840 3300003323 Bacteria 24647
8 Ga0055531_10000327 3300003794 Bacteria 46934
9 Ga0065165_1014947 3300005262 Bacteria 2987
10 Ga0065714_10004821 3300005288 Bacteria 7216
11 Ga0070658_10154455 3300005327 Unclassified 1923
12 Ga0070658_10184573 3300005327 Bacteria 1756
13 Ga0070658_10441812 3300005327 Bacteria 1120
14 Ga0070660_100103929 3300005339 Bacteria 2253
15 Ga0070668_100317630 3300005347 Bacteria 1310
16 Ga0070675_100908995 3300005354 Bacteria 807
17 Ga0070659_100000154 3300005366 Bacteria 52564
18 Ga0070681_10067473 3300005458 Bacteria 3545
19 Ga0068867_100523530 3300005459 Bacteria 1023
20 Ga0068853_100073967 3300005539 Bacteria 2972
21 Ga0070665_100000006 3300005548 Bacteria 718034
22 Ga0068855_100002062 3300005563 Bacteria 24904
23 Ga0068855_100446882 3300005563 Bacteria 1411
24 Ga0070664_100877828 3300005564 Bacteria 840
25 Ga0068857_100348567 3300005577 Bacteria 1371
26 Ga0068856_100043402 3300005614 Bacteria 4424
27 Ga0068856_100713199 3300005614 Bacteria 1023
28 Ga0068852_101361955 3300005616 Unclassified 731
29 Ga0075366_10027376 3300006195 Bacteria 3344
30 Ga0105240_10258393 3300009093 Bacteria 2010
31 Ga0105240_10307474 3300009093 Bacteria 1812
32 Ga0105241_10353899 3300009174 Bacteria 1276
33 Ga0105237_10001662 3300009545 Bacteria 28876
34 Ga0105237_10014099 3300009545 Bacteria 8362
35 Ga0105237_10896227 3300009545 Bacteria 894
36 Ga0105238_10226531 3300009551 Bacteria 1846
37 Ga0105238_10277262 3300009551 Bacteria 1657
38 Ga0105238_10826859 3300009551 Unclassified 943
39 Ga0105249_10418127 3300009553 Bacteria 1374
40 Ga0105249_10511491 3300009553 Bacteria 1247
41 Ga0105239_10000014 3300010375 Bacteria 325391
42 Ga0105239_10000186 3300010375 Bacteria 90998
43 Ga0105239_10089486 3300010375 Bacteria 3394
44 Ga0157371_10000192 3300013102 Bacteria 90362
45 Ga0157371_10034044 3300013102 Bacteria 3658
46 Ga0157370_10162730 3300013104 Bacteria 2076
47 Ga0157369_10096572 3300013105 Bacteria 3152
48 Ga0157374_10066751 3300013296 Bacteria 3381
49 Ga0157374_10159177 3300013296 Bacteria 2199
50 Ga0163162_10008316 3300013306 Bacteria 10124
51 Ga0163162_10025955 3300013306 Bacteria 5790
52 Ga0163162_10119854 3300013306 Bacteria 2734
53 Ga0157372_10011278 3300013307 Bacteria 9508
54 Ga0157372_10417924 3300013307 Bacteria 1563
55 Ga0157379_10222059 3300014968 Bacteria 1712
56 Ga0182005_1000107 3300015265 Bacteria 60831
57 Ga0163161_10225646 3300017792 Unclassified 1452
58 Ga0209436_101424 3300025208 Bacteria 8396
59 Ga0209437_100262 3300025233 Bacteria 81344
60 Ga0209026_1000258 3300025250 Bacteria 65976
61 Ga0209026_1005044 3300025250 Bacteria 3688
62 Ga0209026_1006738 3300025250 Bacteria 2740
63 Ga0209257_1000005 3300025304 Bacteria 1592528
64 Ga0207647_10038189 3300025904 Bacteria 3037
65 Ga0207647_10114973 3300025904 Bacteria 1589
66 Ga0207705_10040953 3300025909 Bacteria 3323
67 Ga0207705_10058488 3300025909 Bacteria 2781
68 Ga0207707_10053541 3300025912 Bacteria 3513
69 Ga0207695_10187569 3300025913 Bacteria 1986
70 Ga0207695_10218800 3300025913 Bacteria 1812
71 Ga0207671_10002505 3300025914 Bacteria 19603
72 Ga0207671_10006194 3300025914 Bacteria 10741
73 Ga0207657_10109311 3300025919 Bacteria 2285
74 Ga0207694_10044494 3300025924 Bacteria 3428
75 Ga0207690_10001547 3300025932 Bacteria 14399
76 Ga0207667_10001302 3300025949 Bacteria 31255
77 Ga0207667_10108835 3300025949 Bacteria 2859
78 Ga0207712_10056557 3300025961 Bacteria 2764
79 Ga0207702_10078500 3300026078 Bacteria 2858
80 Ga0207702_10847074 3300026078 Bacteria 905
81 Ga0207648_10593348 3300026089 Bacteria 1020
82 Ga0207674_10068491 3300026116 Bacteria 3571
83 Ga0207698_10180341 3300026142 Bacteria 1870
84 Ga0268266_10000010 3300028379 Bacteria 1030233
85 Ga0307515_10104762 3300028794 Bacteria 3375
86 Ga0316177_1078711 3300030731 Bacteria 15195
87 Ga0316176_1066110 3300030732 Bacteria 5294
88 Ga0316183_1117238 3300030742 Bacteria 12876
89 Ga0316181_1029685 3300030744 Unclassified 2457
90 Ga0316181_1214260 3300030744 Bacteria 13251
91 Ga0316182_1117588 3300030745 Bacteria 2364
92 Ga0265327_10181156 3300031251 Bacteria 963
93 Ga0307414_10002272 3300032004 Bacteria 10031
94 Ga0307414_10017234 3300032004 Bacteria 4414
95 Ga0307414_10041943 3300032004 Unclassified 3105
96 Ga0451577_0171373 3300042876 Unclassified 1956
97 Ga0495650_0000095 3300046471 Bacteria 218020
98 Ga0495585_0000057 3300046492 Bacteria 113069
99 Ga0495583_0057173 3300046506 Bacteria 1755
100 Ga0495606_0000009 3300046507 Bacteria 306313
101 Ga0495610_0000884 3300046512 Bacteria 27878
102 Ga0495610_0005897 3300046512 Bacteria 8583
103 Ga0495616_0003284 3300046513 Bacteria 10400
104 Ga0495609_0015004 3300046538 Bacteria 3630
105 Ga0495633_0004626 3300046558 Bacteria 8669
106 Ga0495633_0037075 3300046558 Bacteria 2334
107 Ga0495625_0000007 3300046660 Bacteria 565749
108 Ga0495625_0134140 3300046660 Bacteria 1675
109 Ga0495661_0004315 3300046665 Bacteria 10297
110 Ga0495661_0019032 3300046665 Bacteria 4503
111 Ga0495649_0000007 3300046694 Bacteria 518037
112 Ga0495687_000206 3300047443 Bacteria 84323
113 Ga0495687_007395 3300047443 Bacteria 6471
114 Ga0495686_0000267 3300047472 Bacteria 93355
115 Ga0495686_0000558 3300047472 Bacteria 53165
116 Ga0495686_0031884 3300047472 Bacteria 3414
117 Ga0495614_0020099 3300048089 Bacteria 2889
118 Ga0496121_0000043 3300048924 Bacteria 341882
119 Ga0501032_0002176 3300049569 Bacteria 15428
120 Ga0501034_0045586 3300049571 Bacteria 4430
121 Ga0501036_0039281 3300049572 Bacteria 4005
122 Ga0501037_0001536 3300049573 Bacteria 16838
123 Ga0501038_0009199 3300049574 Bacteria 9061
124 Ga0501039_0009461 3300049575 Bacteria 7429
125 Ga0501043_0009336 3300049579 Bacteria 7706
126 Ga0501046_0426851 3300049580 Unclassified 955
127 Ga0501047_0002459 3300049581 Bacteria 17689
128 Ga0501048_0580063 3300049582 Unclassified 805
129 Ga0501241_004112 3300049758 Unclassified 2731
130 Ga0501035_0017122 3300049822 Bacteria 6678
131 Ga0501044_0005431 3300049823 Bacteria 14157
132 nmdc:mga0k408_23015_c1 3300050493 Bacteria 3511
133 Ga0500635_0002702 3300053080 Bacteria 4399
134 Ga0500618_000073 3300053125 Bacteria 81706
135 Ga0500618_019342 3300053125 Bacteria 1677
136 2599481176 2599185184 Bacteria 6430550
137 2738757977 2738541283 Bacteria 7222293
138 2776615941 2775506987 Bacteria 5373360
139 2819576872 2818991442 Bacteria 8318214
140 2821142955 2821136567 Bacteria 8080116
141 2904470682 2904467357 Bacteria 8057758
142 2928081769 2928078545 Bacteria 6534839
143 2928151796 2928147474 Bacteria 6512076
144 2929180631 2929177148 Bacteria 7883697
145 2932087106 2932082852 Bacteria 6563563
146 2945983030 2945977869 Bacteria 7777518
147 2946017575 2946013367 Bacteria 7766675
148 Ga0157371_10043518
149 JGI24735J21928_10000084
150 JGI25162J39368_1000016
151 rootH1_10017112
152 rootH2_10215592
153 rootL2_10140154
154 rootH1_10015840
155 Ga0055531_10000327
156 Ga0065165_1014947
157 Ga0065714_10004821
158 Ga0070658_10154455
159 Ga0070658_10184573
160 Ga0070658_10441812
161 Ga0070660_100103929
162 Ga0070668_100317630
163 Ga0070675_100908995
164 Ga0070659_100000154
165 Ga0070681_10067473
166 Ga0068867_100523530
167 Ga0068853_100073967
168 Ga0070665_100000006
169 Ga0068855_100002062
170 Ga0068855_100446882
171 Ga0070664_100877828
172 Ga0068857_100348567
173 Ga0068856_100043402
174 Ga0068856_100713199
175 Ga0068852_101361955
176 Ga0075366_10027376
177 Ga0105240_10258393
178 Ga0105240_10307474
179 Ga0105241_10353899
180 Ga0105237_10001662
181 Ga0105237_10014099
182 Ga0105237_10896227
183 Ga0105238_10226531
184 Ga0105238_10277262
185 Ga0105238_10826859
186 Ga0105249_10418127
187 Ga0105249_10511491
188 Ga0105239_10000014
189 Ga0105239_10000186
190 Ga0105239_10089486
191 Ga0157371_10000192
192 Ga0157371_10034044
193 Ga0157370_10162730
194 Ga0157369_10096572
195 Ga0157374_10066751
196 Ga0157374_10159177
197 Ga0163162_10008316
198 Ga0163162_10025955
199 Ga0163162_10119854
200 Ga0157372_10011278
201 Ga0157372_10417924
202 Ga0157379_10222059
203 Ga0182005_1000107
204 Ga0163161_10225646
205 Ga0209436_101424
206 Ga0209437_100262
207 Ga0209026_1000258
208 Ga0209026_1005044
209 Ga0209026_1006738
210 Ga0209257_1000005
211 Ga0207647_10038189
212 Ga0207647_10114973
213 Ga0207705_10040953
214 Ga0207705_10058488
215 Ga0207707_10053541
216 Ga0207695_10187569
217 Ga0207695_10218800
218 Ga0207671_10002505
219 Ga0207671_10006194
220 Ga0207657_10109311
221 Ga0207694_10044494
222 Ga0207690_10001547
223 Ga0207667_10001302
224 Ga0207667_10108835
225 Ga0207712_10056557
226 Ga0207702_10078500
227 Ga0207702_10847074
228 Ga0207648_10593348
229 Ga0207674_10068491
230 Ga0207698_10180341
231 Ga0268266_10000010
232 Ga0307515_10104762
233 Ga0316177_1078711
234 Ga0316176_1066110
235 Ga0316183_1117238
236 Ga0316181_1029685
237 Ga0316181_1214260
238 Ga0316182_1117588
239 Ga0265327_10181156
240 Ga0307414_10002272
241 Ga0307414_10017234
242 Ga0307414_10041943
243 Ga0451577_0171373
244 Ga0495650_0000095
245 Ga0495585_0000057
246 Ga0495583_0057173
247 Ga0495606_0000009
248 Ga0495610_0000884
249 Ga0495610_0005897
250 Ga0495616_0003284
251 Ga0495609_0015004
252 Ga0495633_0004626
253 Ga0495633_0037075
254 Ga0495625_0000007
255 Ga0495625_0134140
256 Ga0495661_0004315
257 Ga0495661_0019032
258 Ga0495649_0000007
259 Ga0495687_000206
260 Ga0495687_007395
261 Ga0495686_0000267
262 Ga0495686_0000558
263 Ga0495686_0031884
264 Ga0495614_0020099
265 Ga0496121_0000043
266 Ga0501032_0002176
267 Ga0501034_0045586
268 Ga0501036_0039281
269 Ga0501037_0001536
270 Ga0501038_0009199
271 Ga0501039_0009461
272 Ga0501043_0009336
273 Ga0501046_0426851
274 Ga0501047_0002459
275 Ga0501048_0580063
276 Ga0501241_004112
277 Ga0501035_0017122
278 Ga0501044_0005431
279 nmdc:mga0k408_23015_c1
280 Ga0500635_0002702
281 Ga0500618_000073
282 Ga0500618_019342
283 2599481176
284 2738757977
285 2776615941
286 2819576872
287 2821142955
288 2904470682
289 2928081769
290 2928151796
291 2929180631
292 2932087106
293 2945983030
294 2946017575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

42

110

0.95

Map