F201188

General Info

Members Datasets Scaffolds Average Seq Length
147 122 294 171

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0146792|Ga0451576_0146792_1643_2257
Length 204
Sequence MTDAVYNVLFLCTGNSARSILAECILNREGQGRFKAFSAGSQPKGQVHPFALALLKKMNHPTAGLRSKSWDEFAAPGAPRLNFVFTVCDNAASEVCPAWPGQPMTAHWGVPDPAAAEGTEAERHLAFAESYRMLHNRISIFTSLPLSSIDRLSLQKRLDEIGQSMPRPMPRTGLSQCRRSISIGAPSPSSSARGCWWPPSSVRA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
55 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
65 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
75 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
79 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
84 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
112 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
113 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
114 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
117 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
120 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
121 3004167301 Mesorhizobium loti 582 Isolate Unclassified
122 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 0
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.8
Nodule 0
Rhizoplane 0.68
Rhizosphere 89.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0146792 3300045051 Bacteria 2459
2 JGI25165J46597_1000003 3300003214 Bacteria 694080
3 Ga0055540_1062021 3300003792 Bacteria 745
4 Ga0055531_10002352 3300003794 Bacteria 12725
5 Ga0070658_10564500 3300005327 Bacteria 985
6 Ga0070682_100159827 3300005337 Bacteria 1555
7 Ga0070689_100119824 3300005340 Bacteria 2101
8 Ga0070669_100082849 3300005353 Bacteria 2392
9 Ga0070669_100518972 3300005353 Bacteria 990
10 Ga0070674_100058063 3300005356 Bacteria 2688
11 Ga0070659_100023335 3300005366 Bacteria 4733
12 Ga0070713_100180899 3300005436 Bacteria 1894
13 Ga0070705_100428993 3300005440 Bacteria 986
14 Ga0070679_100043279 3300005530 Bacteria 4485
15 Ga0068853_100000281 3300005539 Bacteria 35996
16 Ga0070696_100013012 3300005546 Bacteria 5582
17 Ga0070665_100348614 3300005548 Bacteria 1486
18 Ga0068855_100220350 3300005563 Bacteria 2128
19 Ga0068857_100004703 3300005577 Bacteria 11572
20 Ga0068857_100277745 3300005577 Bacteria 1540
21 Ga0070702_100289458 3300005615 Bacteria 1128
22 Ga0068862_100758317 3300005844 Bacteria 945
23 Ga0081538_10001256 3300005981 Bacteria 26461
24 Ga0068871_100008567 3300006358 Bacteria 7350
25 Ga0075428_100090970 3300006844 Bacteria 3329
26 Ga0075428_101080422 3300006844 Bacteria 848
27 Ga0075430_100326077 3300006846 Bacteria 1269
28 Ga0075431_100633606 3300006847 Bacteria 1051
29 Ga0075433_10765263 3300006852 Bacteria 844
30 Ga0075434_100300278 3300006871 Bacteria 1626
31 Ga0075429_100042801 3300006880 Bacteria 3941
32 Ga0075436_100126679 3300006914 Bacteria 1789
33 Ga0111539_10253191 3300009094 Bacteria 2050
34 Ga0111539_10254814 3300009094 Bacteria 2043
35 Ga0105249_10021860 3300009553 Bacteria 5729
36 Ga0105249_10483009 3300009553 Bacteria 1282
37 Ga0105249_12594722 3300009553 Bacteria 579
38 Ga0105239_11167673 3300010375 Bacteria 887
39 Ga0157370_10025701 3300013104 Bacteria 5826
40 Ga0157369_10021165 3300013105 Bacteria 7271
41 Ga0157369_10027316 3300013105 Bacteria 6327
42 Ga0157372_10021374 3300013307 Bacteria 6991
43 Ga0157375_10371419 3300013308 Bacteria 1597
44 Ga0157380_11683435 3300014326 Bacteria 691
45 Ga0213872_10045271 3300021361 Bacteria 2002
46 Ga0209233_1000015 3300025261 Bacteria 980563
47 Ga0209676_1080271 3300025292 Bacteria 746
48 Ga0209051_1014447 3300025303 Bacteria 3683
49 Ga0209257_1069927 3300025304 Bacteria 928
50 Ga0207705_10480945 3300025909 Bacteria 964
51 Ga0207652_10028295 3300025921 Bacteria 4676
52 Ga0207681_10345400 3300025923 Bacteria 1190
53 Ga0207712_10462845 3300025961 Bacteria 1078
54 Ga0207639_10000267 3300026041 Bacteria 37378
55 Ga0207678_10448597 3300026067 Bacteria 1121
56 Ga0207674_10010304 3300026116 Bacteria 10601
57 Ga0207674_10424690 3300026116 Bacteria 1284
58 Ga0207698_10795732 3300026142 Bacteria 947
59 Ga0209974_10056598 3300027876 Bacteria 1323
60 Ga0268266_10288678 3300028379 Bacteria 1527
61 Ga0268265_10215718 3300028380 Bacteria 1675
62 Ga0268265_10449570 3300028380 Bacteria 1203
63 Ga0265337_1006260 3300028556 Bacteria 4614
64 Ga0265324_10003449 3300029957 Bacteria 7521
65 Ga0265330_10212852 3300031235 Bacteria 816
66 Ga0265332_10207181 3300031238 Bacteria 814
67 Ga0265328_10006632 3300031239 Bacteria 4874
68 Ga0265328_10007170 3300031239 Bacteria 4666
69 Ga0265328_10011965 3300031239 Bacteria 3460
70 Ga0265328_10102550 3300031239 Bacteria 1060
71 Ga0265339_10165626 3300031249 Bacteria 1110
72 Ga0265331_10000641 3300031250 Bacteria 30240
73 Ga0265331_10008338 3300031250 Bacteria 5900
74 Ga0265331_10155008 3300031250 Bacteria 1039
75 Ga0265327_10000498 3300031251 Bacteria 68290
76 Ga0265327_10009666 3300031251 Bacteria 6916
77 Ga0265327_10129742 3300031251 Bacteria 1187
78 Ga0265316_10028636 3300031344 Bacteria 4592
79 Ga0265316_10053632 3300031344 Bacteria 3159
80 Ga0265316_10147030 3300031344 Bacteria 1767
81 Ga0265313_10154838 3300031595 Bacteria 977
82 Ga0316575_10017995 3300031665 Bacteria 2690
83 Ga0316579_10009010 3300031691 Bacteria 4185
84 Ga0316579_10041292 3300031691 Bacteria 2141
85 Ga0265314_10346161 3300031711 Bacteria 819
86 Ga0265342_10104900 3300031712 Bacteria 1606
87 Ga0316578_10055779 3300031728 Bacteria 2319
88 Ga0307405_10045652 3300031731 Bacteria 2687
89 Ga0307412_10449607 3300031911 Bacteria 1061
90 Ga0307409_100511237 3300031995 Bacteria 1172
91 Ga0307416_100827141 3300032002 Bacteria 1023
92 Ga0307415_100987484 3300032126 Bacteria 782
93 Ga0316583_10001864 3300032133 Bacteria 7177
94 Ga0373955_0106175 3300035172 Bacteria 1619
95 Ga0373955_0377044 3300035172 Bacteria 861
96 Ga0373935_0128681 3300035692 Bacteria 1699
97 Ga0373947_0254865 3300035725 Bacteria 1161
98 Ga0316582_0005996 3300036647 Bacteria 6330
99 Ga0316581_0003898 3300037588 Bacteria 3760
100 Ga0395901_0760387 3300038443 Bacteria 961
101 Ga0400486_22391 3300038742 Bacteria 2527
102 Ga0400486_29407 3300038742 Bacteria 5270
103 Ga0436361_0454948 3300039447 Bacteria 4653
104 Ga0439433_0073784 3300041999 Bacteria 824
105 Ga0439464_0207793 3300042439 Bacteria 626
106 Ga0495592_0257819 3300046454 Bacteria 1150
107 Ga0495638_0026999 3300046460 Bacteria 3718
108 Ga0495651_0241909 3300046462 Bacteria 1237
109 Ga0495664_0425021 3300046477 Bacteria 797
110 Ga0495628_0341132 3300046516 Bacteria 1103
111 Ga0495586_0029210 3300046535 Bacteria 2951
112 Ga0495645_0600521 3300046543 Bacteria 677
113 Ga0495669_0069160 3300046684 Bacteria 1607
114 Ga0495613_0402286 3300046689 Bacteria 934
115 Ga0495602_0124618 3300048088 Bacteria 2067
116 Ga0495602_0174484 3300048088 Bacteria 1665
117 Ga0495602_0518911 3300048088 Bacteria 830
118 Ga0495626_0200678 3300048091 Bacteria 818
119 Ga0496113_0354217 3300048916 Bacteria 1178
120 Ga0501039_0755906 3300049575 Bacteria 759
121 Ga0501070_0427142 3300049586 Bacteria 1070
122 Ga0501072_0315828 3300049588 Bacteria 1242
123 Ga0501077_0297018 3300049593 Bacteria 1029
124 Ga0501080_0312088 3300049742 Bacteria 1425
125 Ga0501080_0484224 3300049742 Bacteria 1107
126 Ga0501044_0858380 3300049823 Bacteria 784
127 nmdc:mga0yw44_326722_c1 3300050492 Bacteria 1030
128 nmdc:mga09592_8101_c1 3300050508 Bacteria 8545
129 nmdc:mga0qj67_547900_c1 3300050509 Bacteria 928
130 nmdc:mga06r32_140874_c1 3300050510 Bacteria 2388
131 nmdc:mga08y16_1304331_c1 3300050511 Bacteria 693
132 nmdc:mga08y16_489364_c1 3300050511 Bacteria 1251
133 nmdc:mga0n895_200853_c1 3300050512 Bacteria 2025
134 nmdc:mga08x19_361286_c1 3300050514 Bacteria 1015
135 nmdc:mga0a205_40182_c1 3300050515 Bacteria 4503
136 Ga0495601_0011035 3300053077 Bacteria 5396
137 Ga0495595_0057077 3300053084 Bacteria 1821
138 Ga0500628_073122 3300053129 Bacteria 863
139 Ga0500616_0026997 3300053153 Bacteria 3174
140 Ga0501084_0000107 3300054114 Bacteria 62192
141 Ga0590071_122074 3300059421 Bacteria 666
142 Ga0590075_050495 3300059424 Bacteria 1067
143 Ga0501082_1235883 3300060353 Bacteria 653
144 Ga0530510_0520072 3300061734 Bacteria 903
145 2574430548 2574179768 Bacteria 4907129
146 3004168374 3004167301 Bacteria 8330599
147 637076415 637000159 Bacteria 7596297
148 Ga0451576_0146792
149 JGI25165J46597_1000003
150 Ga0055540_1062021
151 Ga0055531_10002352
152 Ga0070658_10564500
153 Ga0070682_100159827
154 Ga0070689_100119824
155 Ga0070669_100082849
156 Ga0070669_100518972
157 Ga0070674_100058063
158 Ga0070659_100023335
159 Ga0070713_100180899
160 Ga0070705_100428993
161 Ga0070679_100043279
162 Ga0068853_100000281
163 Ga0070696_100013012
164 Ga0070665_100348614
165 Ga0068855_100220350
166 Ga0068857_100004703
167 Ga0068857_100277745
168 Ga0070702_100289458
169 Ga0068862_100758317
170 Ga0081538_10001256
171 Ga0068871_100008567
172 Ga0075428_100090970
173 Ga0075428_101080422
174 Ga0075430_100326077
175 Ga0075431_100633606
176 Ga0075433_10765263
177 Ga0075434_100300278
178 Ga0075429_100042801
179 Ga0075436_100126679
180 Ga0111539_10253191
181 Ga0111539_10254814
182 Ga0105249_10021860
183 Ga0105249_10483009
184 Ga0105249_12594722
185 Ga0105239_11167673
186 Ga0157370_10025701
187 Ga0157369_10021165
188 Ga0157369_10027316
189 Ga0157372_10021374
190 Ga0157375_10371419
191 Ga0157380_11683435
192 Ga0213872_10045271
193 Ga0209233_1000015
194 Ga0209676_1080271
195 Ga0209051_1014447
196 Ga0209257_1069927
197 Ga0207705_10480945
198 Ga0207652_10028295
199 Ga0207681_10345400
200 Ga0207712_10462845
201 Ga0207639_10000267
202 Ga0207678_10448597
203 Ga0207674_10010304
204 Ga0207674_10424690
205 Ga0207698_10795732
206 Ga0209974_10056598
207 Ga0268266_10288678
208 Ga0268265_10215718
209 Ga0268265_10449570
210 Ga0265337_1006260
211 Ga0265324_10003449
212 Ga0265330_10212852
213 Ga0265332_10207181
214 Ga0265328_10006632
215 Ga0265328_10007170
216 Ga0265328_10011965
217 Ga0265328_10102550
218 Ga0265339_10165626
219 Ga0265331_10000641
220 Ga0265331_10008338
221 Ga0265331_10155008
222 Ga0265327_10000498
223 Ga0265327_10009666
224 Ga0265327_10129742
225 Ga0265316_10028636
226 Ga0265316_10053632
227 Ga0265316_10147030
228 Ga0265313_10154838
229 Ga0316575_10017995
230 Ga0316579_10009010
231 Ga0316579_10041292
232 Ga0265314_10346161
233 Ga0265342_10104900
234 Ga0316578_10055779
235 Ga0307405_10045652
236 Ga0307412_10449607
237 Ga0307409_100511237
238 Ga0307416_100827141
239 Ga0307415_100987484
240 Ga0316583_10001864
241 Ga0373955_0106175
242 Ga0373955_0377044
243 Ga0373935_0128681
244 Ga0373947_0254865
245 Ga0316582_0005996
246 Ga0316581_0003898
247 Ga0395901_0760387
248 Ga0400486_22391
249 Ga0400486_29407
250 Ga0436361_0454948
251 Ga0439433_0073784
252 Ga0439464_0207793
253 Ga0495592_0257819
254 Ga0495638_0026999
255 Ga0495651_0241909
256 Ga0495664_0425021
257 Ga0495628_0341132
258 Ga0495586_0029210
259 Ga0495645_0600521
260 Ga0495669_0069160
261 Ga0495613_0402286
262 Ga0495602_0124618
263 Ga0495602_0174484
264 Ga0495602_0518911
265 Ga0495626_0200678
266 Ga0496113_0354217
267 Ga0501039_0755906
268 Ga0501070_0427142
269 Ga0501072_0315828
270 Ga0501077_0297018
271 Ga0501080_0312088
272 Ga0501080_0484224
273 Ga0501044_0858380
274 nmdc:mga0yw44_326722_c1
275 nmdc:mga09592_8101_c1
276 nmdc:mga0qj67_547900_c1
277 nmdc:mga06r32_140874_c1
278 nmdc:mga08y16_1304331_c1
279 nmdc:mga08y16_489364_c1
280 nmdc:mga0n895_200853_c1
281 nmdc:mga08x19_361286_c1
282 nmdc:mga0a205_40182_c1
283 Ga0495601_0011035
284 Ga0495595_0057077
285 Ga0500628_073122
286 Ga0500616_0026997
287 Ga0501084_0000107
288 Ga0590071_122074
289 Ga0590075_050495
290 Ga0501082_1235883
291 Ga0530510_0520072
292 2574430548
293 3004168374
294 637076415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

8

141

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9546 5 145
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9476 5 145
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9462 5 142
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9218 5 144
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9153 5 144
ID Description Score Start End Superfamily
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8907 6 142 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8856 7 142 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.86 6 149 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8545 6 142 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8479 6 149 3.40.50.2300
ID Description Score Start End GO Terms
AF-V4R5R9-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9954 4 81 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1M3AD64-F1-model_v4 deleted 0.9879 3 84
AF-A9D0N4-F1-model_v4 Protein-tyrosine-phosphatase 0.9863 3 162 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1B1AEV9-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9861 2 163 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A2G2G4D1-F1-model_v4 ArsR family transcriptional regulator 0.9846 2 158 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793

Map