F201731

General Info

Members Datasets Scaffolds Average Seq Length
147 111 294 554

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0002144|Ga0500616_0002144_6986_8785
Length 599
Sequence LKKASGKITEKAGEKEFLKYNNSYPVIIYSYKNDFLTSHAKPKIFLALPIMTNQEIADIFDLLSKLMDIHGENSFKTKTYSTAAYRLEKLSSALAEMSPEQISSISGVGDAVTKKIQDILTTGKLPLLEEYLNKTPPGVVEMLAIKGIGPKKIAVLWKELGAESLGELEYACNENRLITLKGFGAKTQESILKSIAFMRNNMGFYLWAEAEAIALQVKNDLQTAFPDAKIEFTGEYRRQVPALASISFITDLADEQIRSAFELVPDTVFENEEHTLFVQIPNAPTLHFYKCQTQDFYLALFTGTSSPLFAEAFATQYTIPEQAESEEAIFAHNSLSFIPPALRESGDILTKAATNTIPELIQPGDIKGIIHSHSTWSDGVNTLEQMAIAARDKGYEYLVISDHSQAAFYANGLFPERIILQHAEIDMLNEKLAPFRIFKSIEADILHDGSLDYNAEVLSSFDLVIASVHSNLKMNEEKAMQRLLAAIQNPFTTILGHPTGRLLLSREGYPVDHKTLIDACVEHNVVIEINAHPRRLDLDWSWIPYALEKGAMLSVDPDAHSIKGMDLVKYGVYAAQKGGLTKERNLSSMGLAAFENFLK

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
96 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
100 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
101 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
102 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
103 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
104 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
105 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
106 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
107 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
108 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
109 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
110 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
111 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.56
Metatranscriptomes 0
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.97
Nodule 0
Rhizoplane 2.72
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0002144 3300053153 Bacteria 17082
2 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
3 JGI24740J21852_10002103 3300001979 Bacteria 9108
4 JGI24739J22299_10018751 3300001989 Bacteria 2483
5 JGI25154J39366_1000007 3300002738 Bacteria 335932
6 JGI25153J46596_10002940 3300003215 Bacteria 9642
7 rootL2_10088285 3300003322 Bacteria 4992
8 rootH1_10090389 3300003323 Bacteria 8106
9 rootH1_10102767 3300003323 Bacteria 3167
10 JGI25160J50197_1013928 3300003354 Bacteria 2716
11 Ga0055526_1016377 3300003771 Bacteria 2907
12 Ga0055528_1007321 3300003790 Bacteria 4896
13 Ga0055530_10003713 3300003791 Bacteria 8490
14 Ga0055531_10000085 3300003794 Bacteria 102372
15 Ga0065165_1000010 3300005262 Bacteria 323737
16 Ga0065704_10070140 3300005289 Bacteria 482257
17 Ga0070683_100005156 3300005329 Bacteria 10867
18 Ga0070666_10022716 3300005335 Bacteria 4077
19 Ga0068868_100114133 3300005338 Viruses 2198
20 Ga0070675_100031745 3300005354 Bacteria 4272
21 Ga0070673_100065818 3300005364 Bacteria 2892
22 Ga0070659_100005889 3300005366 Bacteria 8831
23 Ga0070663_100095681 3300005455 Bacteria 2208
24 Ga0070681_10009168 3300005458 Bacteria 9723
25 Ga0070681_10142199 3300005458 Bacteria 2329
26 Ga0068867_100007221 3300005459 Bacteria 7855
27 Ga0070679_100054498 3300005530 Bacteria 3981
28 Ga0068853_100016658 3300005539 Bacteria 6053
29 Ga0070665_100000442 3300005548 Bacteria 60619
30 Ga0068855_100000399 3300005563 Bacteria 53597
31 Ga0068855_100005141 3300005563 Bacteria 15959
32 Ga0068855_100026010 3300005563 Bacteria 7000
33 Ga0068856_100011270 3300005614 Bacteria 8678
34 Ga0068856_100042368 3300005614 Bacteria 4478
35 Ga0068852_100040258 3300005616 Bacteria 3941
36 Ga0081539_10001169 3300005985 Bacteria 47510
37 Ga0075366_10008152 3300006195 Bacteria 5813
38 Ga0075431_100049655 3300006847 Bacteria 4325
39 Ga0105240_10000078 3300009093 Bacteria 196646
40 Ga0111539_10067610 3300009094 Bacteria 4219
41 Ga0105241_10157077 3300009174 Bacteria 1866
42 Ga0105237_10001165 3300009545 Bacteria 35143
43 Ga0105239_10000431 3300010375 Bacteria 61098
44 Ga0105239_10037742 3300010375 Bacteria 5295
45 Ga0157373_10003825 3300013100 Bacteria 11378
46 Ga0157373_10058573 3300013100 Bacteria 2731
47 Ga0157371_10001708 3300013102 Bacteria 22354
48 Ga0157371_10003164 3300013102 Bacteria 15153
49 Ga0157371_10007282 3300013102 Bacteria 8988
50 Ga0157371_10008068 3300013102 Bacteria 8420
51 Ga0157371_10011431 3300013102 Bacteria 6840
52 Ga0157371_10053225 3300013102 Bacteria 2874
53 Ga0157371_10095938 3300013102 Bacteria 2101
54 Ga0157370_10000956 3300013104 Bacteria 36647
55 Ga0157370_10002557 3300013104 Bacteria 21831
56 Ga0157370_10005134 3300013104 Bacteria 14766
57 Ga0157370_10005293 3300013104 Bacteria 14491
58 Ga0157370_10106146 3300013104 Bacteria 2629
59 Ga0157369_10002663 3300013105 Bacteria 21313
60 Ga0157369_10005343 3300013105 Bacteria 14966
61 Ga0157374_10056493 3300013296 Bacteria 3664
62 Ga0157374_10129833 3300013296 Bacteria 2438
63 Ga0163162_10002976 3300013306 Bacteria 16179
64 Ga0157372_10015677 3300013307 Bacteria 8127
65 Ga0157372_10143569 3300013307 Bacteria 2753
66 Ga0163163_10119015 3300014325 Bacteria 2674
67 Ga0209646_1000002 3300025246 Bacteria 1425781
68 Ga0209026_1000086 3300025250 Bacteria 185551
69 Ga0209673_1000082 3300025273 Bacteria 219716
70 Ga0209564_1003432 3300025295 Bacteria 10861
71 Ga0209758_1002611 3300025297 Bacteria 17961
72 Ga0209050_1000555 3300025298 Bacteria 61428
73 Ga0207426_1000493 3300025302 Bacteria 59050
74 Ga0209257_1000001 3300025304 Bacteria 2274655
75 Ga0209257_1007531 3300025304 Bacteria 6541
76 Ga0207647_10028451 3300025904 Bacteria 3629
77 Ga0207705_10002548 3300025909 Bacteria 14024
78 Ga0207695_10000064 3300025913 Bacteria 346010
79 Ga0207695_10014224 3300025913 Bacteria 9439
80 Ga0207695_10111187 3300025913 Bacteria 2719
81 Ga0207671_10000030 3300025914 Bacteria 248197
82 Ga0207660_10003854 3300025917 Bacteria 9777
83 Ga0207657_10000872 3300025919 Bacteria 31816
84 Ga0207657_10098104 3300025919 Bacteria 2435
85 Ga0207657_10105043 3300025919 Bacteria 2339
86 Ga0207649_10058594 3300025920 Bacteria 2412
87 Ga0207652_10000228 3300025921 Bacteria 58720
88 Ga0207652_10022299 3300025921 Bacteria 5237
89 Ga0207659_10018839 3300025926 Bacteria 4531
90 Ga0207690_10075674 3300025932 Bacteria 2335
91 Ga0207706_10005563 3300025933 Bacteria 11747
92 Ga0207667_10000312 3300025949 Bacteria 67340
93 Ga0207667_10180466 3300025949 Bacteria 2168
94 Ga0207678_10013732 3300026067 Bacteria 7113
95 Ga0207648_10013767 3300026089 Bacteria 7507
96 Ga0207674_10022907 3300026116 Bacteria 6701
97 Ga0207674_10041696 3300026116 Bacteria 4745
98 Ga0207674_10146944 3300026116 Bacteria 2316
99 Ga0268266_10000845 3300028379 Bacteria 39924
100 Ga0265324_10007521 3300029957 Bacteria 4407
101 Ga0265327_10000026 3300031251 Bacteria 379288
102 Ga0265327_10000137 3300031251 Bacteria 160704
103 Ga0265327_10001558 3300031251 Bacteria 28149
104 Ga0395899_0013279 3300037312 Bacteria 6302
105 Ga0395899_0043494 3300037312 Bacteria 3350
106 Ga0395900_0008777 3300037418 Bacteria 10386
107 Ga0395898_0025804 3300037466 Bacteria 5917
108 Ga0395898_0112715 3300037466 Unclassified 2606
109 Ga0395901_0002103 3300038443 Bacteria 20429
110 Ga0395901_0068958 3300038443 Bacteria 3683
111 Ga0439431_0000340 3300041997 Bacteria 9775
112 Ga0453684_0036901 3300044712 Bacteria 6723
113 Ga0466970_0023647 3300044765 Bacteria 3211
114 Ga0466960_0059014 3300044901 Bacteria 1876
115 Ga0495594_0073275 3300046499 Unclassified 1906
116 Ga0495668_0000057 3300046616 Bacteria 196557
117 Ga0495668_0000878 3300046616 Bacteria 33873
118 Ga0495668_0006718 3300046616 Bacteria 7491
119 Ga0495600_0017098 3300046809 Bacteria 4611
120 Ga0495636_0000062 3300047318 Bacteria 47016
121 Ga0495686_0001275 3300047472 Bacteria 28512
122 Ga0496114_0000420 3300048917 Bacteria 31391
123 Ga0496115_0069945 3300048918 Bacteria 2844
124 Ga0496126_0095626 3300048929 Bacteria 2605
125 Ga0501034_0066634 3300049571 Bacteria 3614
126 Ga0501038_0077895 3300049574 Bacteria 2798
127 Ga0501047_0012511 3300049581 Bacteria 8037
128 Ga0501219_000173 3300049703 Bacteria 12003
129 Ga0501035_0110701 3300049822 Bacteria 2407
130 Ga0501044_0179179 3300049823 Bacteria 2087
131 Ga0501284_00032 3300050005 Bacteria 64343
132 nmdc:mga0k408_7338_c1 3300050493 Bacteria 5888
133 nmdc:mga06r32_36948_c1 3300050510 Bacteria 4620
134 nmdc:mga08y16_38709_c1 3300050511 Bacteria 5005
135 Ga0500642_0020219 3300053130 Bacteria 2613
136 Ga0500652_014903 3300053131 Bacteria 2793
137 Ga0500604_0006745 3300053151 Unclassified 3039
138 Ga0500622_0000077 3300053156 Bacteria 108558
139 Ga0500627_0003721 3300053158 Bacteria 4776
140 2600198059 2599185353 Bacteria 2219443
141 2600400837 2600254943 Bacteria 2613887
142 2840677515 2840677318 Bacteria 2664183
143 2881956127 2881955468 Bacteria 3545609
144 2883072900 2883068021 Bacteria 6192739
145 2896085333 2896085136 Bacteria 6129793
146 2929923487 2929921140 Bacteria 8649150
147 8003152889 8003151029 Bacteria 8187759
148 Ga0500616_0002144
149 SwRhRL2b_contig_1663050
150 JGI24740J21852_10002103
151 JGI24739J22299_10018751
152 JGI25154J39366_1000007
153 JGI25153J46596_10002940
154 rootL2_10088285
155 rootH1_10090389
156 rootH1_10102767
157 JGI25160J50197_1013928
158 Ga0055526_1016377
159 Ga0055528_1007321
160 Ga0055530_10003713
161 Ga0055531_10000085
162 Ga0065165_1000010
163 Ga0065704_10070140
164 Ga0070683_100005156
165 Ga0070666_10022716
166 Ga0068868_100114133
167 Ga0070675_100031745
168 Ga0070673_100065818
169 Ga0070659_100005889
170 Ga0070663_100095681
171 Ga0070681_10009168
172 Ga0070681_10142199
173 Ga0068867_100007221
174 Ga0070679_100054498
175 Ga0068853_100016658
176 Ga0070665_100000442
177 Ga0068855_100000399
178 Ga0068855_100005141
179 Ga0068855_100026010
180 Ga0068856_100011270
181 Ga0068856_100042368
182 Ga0068852_100040258
183 Ga0081539_10001169
184 Ga0075366_10008152
185 Ga0075431_100049655
186 Ga0105240_10000078
187 Ga0111539_10067610
188 Ga0105241_10157077
189 Ga0105237_10001165
190 Ga0105239_10000431
191 Ga0105239_10037742
192 Ga0157373_10003825
193 Ga0157373_10058573
194 Ga0157371_10001708
195 Ga0157371_10003164
196 Ga0157371_10007282
197 Ga0157371_10008068
198 Ga0157371_10011431
199 Ga0157371_10053225
200 Ga0157371_10095938
201 Ga0157370_10000956
202 Ga0157370_10002557
203 Ga0157370_10005134
204 Ga0157370_10005293
205 Ga0157370_10106146
206 Ga0157369_10002663
207 Ga0157369_10005343
208 Ga0157374_10056493
209 Ga0157374_10129833
210 Ga0163162_10002976
211 Ga0157372_10015677
212 Ga0157372_10143569
213 Ga0163163_10119015
214 Ga0209646_1000002
215 Ga0209026_1000086
216 Ga0209673_1000082
217 Ga0209564_1003432
218 Ga0209758_1002611
219 Ga0209050_1000555
220 Ga0207426_1000493
221 Ga0209257_1000001
222 Ga0209257_1007531
223 Ga0207647_10028451
224 Ga0207705_10002548
225 Ga0207695_10000064
226 Ga0207695_10014224
227 Ga0207695_10111187
228 Ga0207671_10000030
229 Ga0207660_10003854
230 Ga0207657_10000872
231 Ga0207657_10098104
232 Ga0207657_10105043
233 Ga0207649_10058594
234 Ga0207652_10000228
235 Ga0207652_10022299
236 Ga0207659_10018839
237 Ga0207690_10075674
238 Ga0207706_10005563
239 Ga0207667_10000312
240 Ga0207667_10180466
241 Ga0207678_10013732
242 Ga0207648_10013767
243 Ga0207674_10022907
244 Ga0207674_10041696
245 Ga0207674_10146944
246 Ga0268266_10000845
247 Ga0265324_10007521
248 Ga0265327_10000026
249 Ga0265327_10000137
250 Ga0265327_10001558
251 Ga0395899_0013279
252 Ga0395899_0043494
253 Ga0395900_0008777
254 Ga0395898_0025804
255 Ga0395898_0112715
256 Ga0395901_0002103
257 Ga0395901_0068958
258 Ga0439431_0000340
259 Ga0453684_0036901
260 Ga0466970_0023647
261 Ga0466960_0059014
262 Ga0495594_0073275
263 Ga0495668_0000057
264 Ga0495668_0000878
265 Ga0495668_0006718
266 Ga0495600_0017098
267 Ga0495636_0000062
268 Ga0495686_0001275
269 Ga0496114_0000420
270 Ga0496115_0069945
271 Ga0496126_0095626
272 Ga0501034_0066634
273 Ga0501038_0077895
274 Ga0501047_0012511
275 Ga0501219_000173
276 Ga0501035_0110701
277 Ga0501044_0179179
278 Ga0501284_00032
279 nmdc:mga0k408_7338_c1
280 nmdc:mga06r32_36948_c1
281 nmdc:mga08y16_38709_c1
282 Ga0500642_0020219
283 Ga0500652_014903
284 Ga0500604_0006745
285 Ga0500622_0000077
286 Ga0500627_0003721
287 2600198059
288 2600400837
289 2840677515
290 2881956127
291 2883072900
292 2896085333
293 2929923487
294 8003152889

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14716

HHH_8

Helix-hairpin-helix domain

53

121

0.97

PF14520

HHH_5

Helix-hairpin-helix domain

139

196

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m65-assembly1.cif.gz_A ycdx protein 0.8815 318 553
3au6-assembly1.cif.gz_A dna polymerase x from thermus thermophilus hb8 ternary complex with primer/template dna and ddgtp 0.8661 1 551
3au6-assembly1.cif.gz_A dna polymerase x from thermus thermophilus hb8 ternary complex with primer/template dna and ddgtp 0.8561 1 551
1m65-assembly1.cif.gz_A ycdx protein 0.8354 318 553
1pb0-assembly1.cif.gz_A ycdx protein in autoinhibited state 0.8303 317 553
ID Description Score Start End Superfamily
2w9mA05 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9699 310 555 3.20.20.140
af_Q2FZD4_322_570_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9674 311 557 3.20.20.140
2w9mB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9547 86 152 1.10.150.20
3au6A05 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9507 308 551 3.20.20.140
af_Q2FZD4_322_570_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9484 311 557 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A259HI57-F1-model_v4 Histidinol-phosphatase 0.9899 322 556 GO:0005829
GO:0008270
GO:0042578
AF-A0A3D3CWE4-F1-model_v4 Histidinol-phosphatase 0.9893 275 551 GO:0005829
GO:0008270
GO:0042578
GO:0071978
AF-A0A4Q3ST74-F1-model_v4 PHP domain-containing protein 0.9849 373 556 GO:0005829
GO:0008270
GO:0042578
GO:0071978
AF-A0A7C3XT46-F1-model_v4 PHP domain-containing protein 0.9802 350 554 GO:0005829
GO:0008270
GO:0042578
GO:0071978
AF-A0A4Q3ND94-F1-model_v4 deleted 0.9794 451 556

Map