F203363

General Info

Members Datasets Scaffolds Average Seq Length
148 119 296 328

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10014546|Ga0207657_100145466
Length 380
Sequence MPAIETRGLTKTYVSHKKEPGILGSLKGLFTKEKVEVQAVQSVDLEIGQGELVGFLGPNGAGKTTTLKMLSGILYPSGGEAKVLGYTPHHRKPEMLRQISLVMGNKMQLWWDLPAWDSFVVLKELYEVSDAQFKKRSDHLVEVLDLGDKIHTQVRKLSLGERMKCELVAALLHSPRVIFLDEPTIGLDVVSQKRIREFLKQLHQEDNCTIILTSHYMQDVQELCDRVVVIDHGQLVFEGKLEELSNRYSETRRIRLAFSTEVSLTDLEKFGKVIESEPLLATFEVPRQETTKATARMLQHLPVSDVAIQEVDIEDVIRDVAQTGVKVVMSTHDLGQARRLGGDIVLLHRGRLIEHTQASDFFDNPRTPEARRFIAGELLV

Samples

Sample ID Description Type Environment
1 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
16 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
17 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
34 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
48 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
49 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
50 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
51 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
52 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
53 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
57 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
58 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
61 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
64 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
65 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
76 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
77 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
78 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
79 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
80 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
81 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
82 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
83 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
86 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
87 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
88 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
89 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
90 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
93 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
94 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
95 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
96 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
97 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
98 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
99 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
100 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
101 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
102 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
103 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
104 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
105 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
106 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
107 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
108 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
109 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
110 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
111 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
112 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
113 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
114 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
115 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
116 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
117 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
118 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
119 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.05
Metatranscriptomes 1.35
Isolates 19.59

Biome Distribution

Category Percentage (%)
Aerial Root 1.35
Bulb 0
Endosphere 2.7
Nodule 3.38
Rhizoplane 2.03
Rhizosphere 70.95
Stem 0
Stem Tuber 0
Unclassified 1.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207657_10014546 3300025919 Bacteria 7673
2 rootH1_10089812 3300003323 Bacteria 2625
3 JGI25405J52794_10008470 3300003911 Bacteria 1921
4 Ga0065715_10011873 3300005293 Bacteria 2349
5 Ga0070658_10000910 3300005327 Bacteria 25346
6 Ga0070666_10140089 3300005335 Bacteria 1685
7 Ga0070660_100002581 3300005339 Bacteria 12430
8 Ga0070660_100003675 3300005339 Bacteria 10596
9 Ga0070711_100001116 3300005439 Bacteria 14358
10 Ga0068853_100339230 3300005539 Bacteria 1396
11 Ga0070686_100328716 3300005544 Bacteria 1142
12 Ga0068855_100109260 3300005563 Bacteria 3176
13 Ga0068863_100000827 3300005841 Bacteria 31061
14 Ga0081539_10020461 3300005985 Bacteria 4471
15 Ga0075431_100017292 3300006847 Bacteria 7328
16 Ga0075431_100018980 3300006847 Bacteria 7005
17 Ga0068865_100129064 3300006881 Bacteria 1892
18 Ga0075436_100245784 3300006914 Bacteria 1273
19 Ga0079104_1000329 3300006946 Bacteria 58106
20 Ga0079104_1000622 3300006946 Bacteria 34711
21 Ga0105251_10007078 3300009011 Bacteria 6990
22 Ga0105244_10066877 3300009036 Bacteria 1799
23 Ga0105240_10000223 3300009093 Bacteria 113647
24 Ga0114129_10182126 3300009147 Bacteria 2858
25 Ga0105237_10000003 3300009545 Bacteria 556908
26 Ga0105237_10000392 3300009545 Bacteria 62305
27 Ga0105237_10004006 3300009545 Bacteria 17226
28 Ga0105238_10152420 3300009551 Bacteria 2286
29 Ga0105239_10036710 3300010375 Bacteria 5377
30 Ga0105239_10071351 3300010375 Bacteria 3816
31 Ga0105246_10003836 3300011119 Bacteria 9115
32 Ga0157374_10112143 3300013296 Bacteria 2624
33 Ga0157378_10331649 3300013297 Bacteria 1481
34 Ga0157372_10024202 3300013307 Bacteria 6592
35 Ga0157375_10316739 3300013308 Bacteria 1724
36 Ga0213876_10060262 3300021384 Bacteria 2002
37 Ga0213875_10046431 3300021388 Bacteria 2038
38 Ga0209566_107368 3300025225 Bacteria 1240
39 Ga0209437_100738 3300025233 Bacteria 16283
40 Ga0207655_1021648 3300025728 Bacteria 3255
41 Ga0207642_10171870 3300025899 Bacteria 1173
42 Ga0207680_10118671 3300025903 Bacteria 1727
43 Ga0207705_10001080 3300025909 Bacteria 22137
44 Ga0207695_10000326 3300025913 Bacteria 113674
45 Ga0207671_10000012 3300025914 Bacteria 519494
46 Ga0207671_10000108 3300025914 Bacteria 128664
47 Ga0207657_10107189 3300025919 Bacteria 2311
48 Ga0207703_10119062 3300026035 Bacteria 2264
49 Ga0207708_10119842 3300026075 Bacteria 2050
50 Ga0209281_1000153 3300027111 Bacteria 166921
51 Ga0209281_1000252 3300027111 Bacteria 106924
52 Ga0265338_10000071 3300028800 Bacteria 184107
53 Ga0265338_10000736 3300028800 Bacteria 55849
54 Ga0265324_10000944 3300029957 Bacteria 18201
55 Ga0307511_10002795 3300030521 Bacteria 18127
56 Ga0265331_10060687 3300031250 Bacteria 1786
57 Ga0316576_10008376 3300031727 Bacteria 6589
58 Ga0316578_10016123 3300031728 Bacteria 4037
59 Ga0307507_10027164 3300033179 Bacteria 6144
60 Ga0373943_0032099 3300035170 Bacteria 2495
61 Ga0316582_0002004 3300036647 Bacteria 9345
62 Ga0316584_0051630 3300036712 Bacteria 3075
63 Ga0316584_0087752 3300036712 Bacteria 2329
64 Ga0316584_0313772 3300036712 Bacteria 1133
65 Ga0373925_0005840 3300037068 Bacteria 9132
66 Ga0395900_0005656 3300037418 Bacteria 13073
67 Ga0395898_0003171 3300037466 Bacteria 18527
68 Ga0436364_0979827 3300037853 Bacteria 16069
69 Ga0400483_141423 3300039062 Bacteria 1868
70 Ga0400489_30971 3300039093 Bacteria 5477
71 Ga0436365_0796272 3300039437 Bacteria 31906
72 Ga0439439_0027264 3300041406 Bacteria 1443
73 Ga0439449_0013903 3300042007 Bacteria 3027
74 Ga0451577_0376346 3300042876 Bacteria 1288
75 Ga0466969_0006065 3300044656 Bacteria 6431
76 Ga0466972_0018241 3300044658 Bacteria 3508
77 Ga0453683_0171508 3300044673 Bacteria 1374
78 Ga0466965_0009293 3300044683 Bacteria 4568
79 Ga0466965_0151514 3300044683 Bacteria 1212
80 Ga0453684_0000581 3300044712 Bacteria 136088
81 Ga0453684_0001027 3300044712 Bacteria 89253
82 Ga0453684_0001460 3300044712 Bacteria 66976
83 Ga0453684_0001537 3300044712 Bacteria 64502
84 Ga0453684_0006759 3300044712 Bacteria 21584
85 Ga0453684_0013769 3300044712 Bacteria 13076
86 Ga0453684_0027968 3300044712 Bacteria 8065
87 Ga0453684_0055080 3300044712 Bacteria 5173
88 Ga0453684_0119944 3300044712 Bacteria 3178
89 Ga0453684_0143427 3300044712 Bacteria 2848
90 Ga0453684_0195284 3300044712 Bacteria 2364
91 Ga0453684_0396103 3300044712 Unclassified 1547
92 Ga0466968_0007795 3300044735 Bacteria 4082
93 Ga0466957_0105697 3300044842 Unclassified 1780
94 Ga0466960_0001014 3300044901 Bacteria 10033
95 Ga0466959_0000830 3300045049 Bacteria 18236
96 Ga0451576_0104639 3300045051 Bacteria 2944
97 Ga0451576_0114404 3300045051 Bacteria 2808
98 Ga0495660_0058998 3300046810 Bacteria 2065
99 Ga0496110_0587720 3300048913 Bacteria 1011
100 Ga0496115_0003512 3300048918 Bacteria 11266
101 Ga0496116_0033615 3300048919 Bacteria 3635
102 Ga0496117_0018702 3300048920 Bacteria 5724
103 Ga0496119_0034137 3300048922 Bacteria 3357
104 Ga0496120_0121422 3300048923 Bacteria 1350
105 Ga0496122_0097907 3300048925 Bacteria 1972
106 Ga0496123_0038391 3300048926 Bacteria 3367
107 Ga0496124_0074949 3300048927 Bacteria 2796
108 Ga0496124_0116660 3300048927 Bacteria 2140
109 Ga0496126_0004115 3300048929 Bacteria 17601
110 nmdc:mga05p37_222803_c1 3300050507 Bacteria 2275
111 nmdc:mga05p37_7605_c1 3300050507 Bacteria 12784
112 nmdc:mga0qj67_14264_c1 3300050509 Bacteria 6005
113 nmdc:mga06r32_11518_c1 3300050510 Bacteria 7967
114 nmdc:mga06r32_2912_c1 3300050510 Bacteria 15350
115 nmdc:mga0a205_102746_c1 3300050515 Bacteria 2756
116 Ga0500555_000003 3300053103 Bacteria 392994
117 Ga0500616_0000050 3300053153 Bacteria 299099
118 Ga0587082_000085 3300059504 Bacteria 5119
119 Ga0587079_000014 3300059647 Bacteria 9213
120 2524185887 2524023129 Bacteria 6762600
121 2676477753 2675903058 Bacteria 6822861
122 2723605644 2721755693 Bacteria 6126117
123 2730136320 2728369359 Bacteria 5621728
124 2753810288 2751185905 Bacteria 6142767
125 2787437248 2786546517 Bacteria 6614109
126 2802438758 2802428803 Bacteria 5806948
127 2817616879 2816332336 Bacteria 5207640
128 2827634330 2827628540 Bacteria 6858585
129 2864737027 2864733723 Bacteria 6770668
130 2875396553 2875391855 Bacteria 7600475
131 2885531578 2885526491 Bacteria 7164189
132 2889281623 2889276214 Bacteria 5979355
133 2904163888 2904162308 Bacteria 7086713
134 2904599052 2904595352 Bacteria 6124848
135 2907203604 2907202186 Bacteria 6632024
136 2929211647 2929206907 Bacteria 5918291
137 2939683391 2939679117 Bacteria 6921672
138 2939704172 2939702853 Bacteria 5139229
139 2971405358 2971403814 Bacteria 7370929
140 2971407526 2971403814 Bacteria 7370929
141 2971416833 2971410472 Bacteria 8311090
142 2984528585 2984527788 Bacteria 5288478
143 2984534689 2984532647 Bacteria 5288506
144 2995951728 2995948881 Bacteria 6358104
145 2996710332 2996706504 Bacteria 5757485
146 648171692 648028048 Bacteria 5394884
147 8054797107 8054795415 Bacteria 9785225
148 8055635277 8055632911 Bacteria 5283357
149 Ga0207657_10014546
150 rootH1_10089812
151 JGI25405J52794_10008470
152 Ga0065715_10011873
153 Ga0070658_10000910
154 Ga0070666_10140089
155 Ga0070660_100002581
156 Ga0070660_100003675
157 Ga0070711_100001116
158 Ga0068853_100339230
159 Ga0070686_100328716
160 Ga0068855_100109260
161 Ga0068863_100000827
162 Ga0081539_10020461
163 Ga0075431_100017292
164 Ga0075431_100018980
165 Ga0068865_100129064
166 Ga0075436_100245784
167 Ga0079104_1000329
168 Ga0079104_1000622
169 Ga0105251_10007078
170 Ga0105244_10066877
171 Ga0105240_10000223
172 Ga0114129_10182126
173 Ga0105237_10000003
174 Ga0105237_10000392
175 Ga0105237_10004006
176 Ga0105238_10152420
177 Ga0105239_10036710
178 Ga0105239_10071351
179 Ga0105246_10003836
180 Ga0157374_10112143
181 Ga0157378_10331649
182 Ga0157372_10024202
183 Ga0157375_10316739
184 Ga0213876_10060262
185 Ga0213875_10046431
186 Ga0209566_107368
187 Ga0209437_100738
188 Ga0207655_1021648
189 Ga0207642_10171870
190 Ga0207680_10118671
191 Ga0207705_10001080
192 Ga0207695_10000326
193 Ga0207671_10000012
194 Ga0207671_10000108
195 Ga0207657_10107189
196 Ga0207703_10119062
197 Ga0207708_10119842
198 Ga0209281_1000153
199 Ga0209281_1000252
200 Ga0265338_10000071
201 Ga0265338_10000736
202 Ga0265324_10000944
203 Ga0307511_10002795
204 Ga0265331_10060687
205 Ga0316576_10008376
206 Ga0316578_10016123
207 Ga0307507_10027164
208 Ga0373943_0032099
209 Ga0316582_0002004
210 Ga0316584_0051630
211 Ga0316584_0087752
212 Ga0316584_0313772
213 Ga0373925_0005840
214 Ga0395900_0005656
215 Ga0395898_0003171
216 Ga0436364_0979827
217 Ga0400483_141423
218 Ga0400489_30971
219 Ga0436365_0796272
220 Ga0439439_0027264
221 Ga0439449_0013903
222 Ga0451577_0376346
223 Ga0466969_0006065
224 Ga0466972_0018241
225 Ga0453683_0171508
226 Ga0466965_0009293
227 Ga0466965_0151514
228 Ga0453684_0000581
229 Ga0453684_0001027
230 Ga0453684_0001460
231 Ga0453684_0001537
232 Ga0453684_0006759
233 Ga0453684_0013769
234 Ga0453684_0027968
235 Ga0453684_0055080
236 Ga0453684_0119944
237 Ga0453684_0143427
238 Ga0453684_0195284
239 Ga0453684_0396103
240 Ga0466968_0007795
241 Ga0466957_0105697
242 Ga0466960_0001014
243 Ga0466959_0000830
244 Ga0451576_0104639
245 Ga0451576_0114404
246 Ga0495660_0058998
247 Ga0496110_0587720
248 Ga0496115_0003512
249 Ga0496116_0033615
250 Ga0496117_0018702
251 Ga0496119_0034137
252 Ga0496120_0121422
253 Ga0496122_0097907
254 Ga0496123_0038391
255 Ga0496124_0074949
256 Ga0496124_0116660
257 Ga0496126_0004115
258 nmdc:mga05p37_222803_c1
259 nmdc:mga05p37_7605_c1
260 nmdc:mga0qj67_14264_c1
261 nmdc:mga06r32_11518_c1
262 nmdc:mga06r32_2912_c1
263 nmdc:mga0a205_102746_c1
264 Ga0500555_000003
265 Ga0500616_0000050
266 Ga0587082_000085
267 Ga0587079_000014
268 2524185887
269 2676477753
270 2723605644
271 2730136320
272 2753810288
273 2787437248
274 2802438758
275 2817616879
276 2827634330
277 2864737027
278 2875396553
279 2885531578
280 2889281623
281 2904163888
282 2904599052
283 2907203604
284 2929211647
285 2939683391
286 2939704172
287 2971405358
288 2971407526
289 2971416833
290 2984528585
291 2984534689
292 2995951728
293 2996710332
294 648171692
295 8054797107
296 8055635277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

40

185

0.89

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

117

216

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.8976 2 246
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.8965 2 246
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.8921 2 246
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.8902 2 238
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.8898 2 245
ID Description Score Start End Superfamily
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9458 2 242 3.40.50.300
af_Q8T6J5_1286_1532_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9438 2 246 3.40.50.300
af_Q4DWA3_1535_1779_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9429 2 242 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9428 2 245 3.40.50.300
af_A4HRM7_1245_1429_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9388 63 245 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V5DKD2-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9559 1 238 GO:0005524
GO:0016887
GO:0017004
GO:0022857
AF-A0A1D2R6P7-F1-model_v4 ABC transporter domain-containing protein 0.9424 1 246 GO:0005524
GO:0016887
AF-A0A535F3M6-F1-model_v4 ABC transporter ATP-binding protein 0.9418 1 245 GO:0005524
GO:0016887
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9397 2 203 GO:0005524
GO:0016887
AF-A0A7T7XM26-F1-model_v4 ABC transporter ATP-binding protein 0.9389 2 244 GO:0005524
GO:0016887

Map