F205124

General Info

Members Datasets Scaffolds Average Seq Length
149 111 149 326

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100107836|Ga0070689_1001078363
Length 346
Sequence LLPSNPRTYTSAHLQLMSHSPVRVAVTGAAGQIGYSLLFRIASGALFGPDQQVVLHLIEIEPALPALQGVVMELDDCAFPLLADVVPTANLDEGFRGVNWALLVGSVPRKQGMERKDLLGINGKIFVGQGRAIQQNAAPDVRVLVVGNPCNTNCLIAMSNAPDVPRDRWHAMTRLDENRAKGLLATKAGLAVTDVTNVAIWGNHSATQYPDFSNAKINGRPATDTIKDQSWLQGDFIATVQQRGAAIIKARGASSAGSAANAILDTVRSIIEPTPASDWHSAGVCSDGSYGVEPGLISSFPVRSDGGKLEVVPGLPIDVFSRARIDASVNELKEEKSMVAELLARH

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
28 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
29 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
41 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
42 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
54 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
55 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
56 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
57 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
58 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
59 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
60 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
61 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
62 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
103 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
109 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.7
Nodule 0
Rhizoplane 2.68
Rhizosphere 87.25
Stem 0
Stem Tuber 0
Unclassified 5.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10007596 3300003659 Bacteria 2296
2 Ga0070658_10001371 3300005327 Bacteria 20834
3 Ga0070690_100150841 3300005330 Bacteria 1586
4 Ga0070689_100016431 3300005340 Bacteria 5416
5 Ga0070689_100022132 3300005340 Bacteria 4744
6 Ga0070689_100048405 3300005340 Bacteria 3279
7 Ga0070689_100052157 3300005340 Bacteria 3163
8 Ga0070689_100107836 3300005340 Bacteria 2212
9 Ga0070687_100123140 3300005343 Bacteria 1486
10 Ga0070688_100055880 3300005365 Bacteria 2477
11 Ga0070711_100085307 3300005439 Bacteria 2262
12 Ga0070694_100017042 3300005444 Bacteria 4585
13 Ga0070708_100141448 3300005445 Bacteria 2231
14 Ga0070704_100001090 3300005549 Bacteria 14087
15 Ga0068855_100128960 3300005563 Bacteria 2890
16 Ga0068855_100712945 3300005563 Bacteria 1073
17 Ga0068859_100189515 3300005617 Bacteria 2141
18 Ga0068863_100041131 3300005841 Bacteria 4394
19 Ga0081538_10000023 3300005981 Bacteria 131101
20 Ga0081540_1000358 3300005983 Bacteria 46046
21 Ga0075365_10000493 3300006038 Bacteria 15046
22 Ga0075365_10043041 3300006038 Bacteria 2955
23 Ga0075364_10002586 3300006051 Bacteria 10144
24 Ga0075428_100017762 3300006844 Bacteria 7860
25 Ga0075428_100070591 3300006844 Bacteria 3818
26 Ga0075428_100556724 3300006844 Bacteria 1226
27 Ga0075430_100266914 3300006846 Bacteria 1417
28 Ga0075431_100004630 3300006847 Bacteria 13508
29 Ga0075434_100070693 3300006871 Bacteria 3481
30 Ga0097620_100189515 3300006931 Bacteria 2141
31 Ga0111539_10079741 3300009094 Bacteria 3851
32 Ga0111539_10207766 3300009094 Bacteria 2282
33 Ga0111539_10302253 3300009094 Bacteria 1862
34 Ga0105237_10002879 3300009545 Bacteria 20911
35 Ga0157370_10103542 3300013104 Bacteria 2664
36 Ga0157372_10098326 3300013307 Bacteria 3339
37 Ga0213874_10023545 3300021377 Bacteria 1719
38 Ga0213876_10000851 3300021384 Bacteria 20550
39 Ga0213875_10000086 3300021388 Bacteria 106719
40 Ga0207705_10004316 3300025909 Bacteria 10757
41 Ga0207671_10093977 3300025914 Bacteria 2262
42 Ga0207693_10139352 3300025915 Bacteria 1907
43 Ga0207663_10068043 3300025916 Bacteria 2286
44 Ga0207663_10207749 3300025916 Unclassified 1417
45 Ga0207662_10025826 3300025918 Bacteria 3385
46 Ga0207681_10176424 3300025923 Bacteria 1624
47 Ga0207670_10005487 3300025936 Bacteria 6968
48 Ga0207670_10028541 3300025936 Bacteria 3544
49 Ga0207670_10085656 3300025936 Bacteria 2215
50 Ga0207667_10098330 3300025949 Bacteria 3020
51 Ga0207702_10004230 3300026078 Bacteria 12823
52 Ga0207641_10004274 3300026088 Bacteria 12416
53 Ga0207641_10022583 3300026088 Bacteria 5179
54 Ga0207428_10106611 3300027907 Bacteria 2160
55 Ga0207428_10260633 3300027907 Unclassified 1291
56 Ga0265356_1002581 3300028017 Bacteria 2387
57 Ga0268265_10574875 3300028380 Bacteria 1073
58 Ga0268264_10274653 3300028381 Unclassified 1576
59 Ga0265337_1000109 3300028556 Bacteria 41843
60 Ga0265326_10014378 3300028558 Bacteria 2306
61 Ga0265334_10004775 3300028573 Bacteria 5957
62 Ga0265336_10010597 3300028666 Bacteria 3156
63 Ga0265338_10001410 3300028800 Bacteria 39134
64 Ga0265338_10006950 3300028800 Bacteria 14232
65 Ga0265338_10025937 3300028800 Bacteria 5926
66 Ga0265324_10000382 3300029957 Bacteria 32039
67 Ga0265324_10004333 3300029957 Bacteria 6463
68 Ga0265762_1002447 3300030760 Unclassified 3361
69 Ga0265339_10036896 3300031249 Bacteria 2733
70 Ga0265327_10024269 3300031251 Bacteria 3568
71 Ga0373928_0000932 3300035084 Bacteria 5739
72 Ga0373929_0001750 3300035085 Bacteria 4083
73 Ga0373944_0000013 3300035089 Bacteria 33114
74 Ga0373949_0001926 3300035090 Bacteria 5593
75 Ga0373951_0003243 3300035091 Bacteria 3981
76 Ga0373932_0000001 3300035112 Bacteria 1459067
77 Ga0373945_0010213 3300035116 Bacteria 3088
78 Ga0373956_0007492 3300035119 Bacteria 4396
79 Ga0373962_0000043 3300035242 Bacteria 29210
80 Ga0373931_0000002 3300035691 Bacteria 599830
81 Ga0373935_0101692 3300035692 Bacteria 1896
82 Ga0373927_0005241 3300035695 Bacteria 8970
83 Ga0373947_0014734 3300035725 Bacteria 4485
84 Ga0373947_0079573 3300035725 Bacteria 2026
85 Ga0373937_0221281 3300036401 Unclassified 1782
86 Ga0373925_0000352 3300037068 Bacteria 47960
87 Ga0373925_0002072 3300037068 Bacteria 16511
88 Ga0436364_0985190 3300037853 Bacteria 106787
89 Ga0436365_0413769 3300039437 Bacteria 34100
90 Ga0436363_1386368 3300039450 Bacteria 8268
91 Ga0451577_0024977 3300042876 Bacteria 5427
92 Ga0453684_0199704 3300044712 Bacteria 2332
93 Ga0451576_0053338 3300045051 Bacteria 4236
94 Ga0451576_0069311 3300045051 Bacteria 3670
95 Ga0451576_0244431 3300045051 Bacteria 1875
96 Ga0495592_0028463 3300046454 Bacteria 4232
97 Ga0495582_0048723 3300046473 Bacteria 2333
98 Ga0495662_0089225 3300046476 Bacteria 1502
99 Ga0495608_0006290 3300046511 Bacteria 8423
100 Ga0495628_0000789 3300046516 Bacteria 29129
101 Ga0495630_0000305 3300046517 Bacteria 39378
102 Ga0495630_0012668 3300046517 Bacteria 6129
103 Ga0495666_0023723 3300046526 Bacteria 3033
104 Ga0495652_0012182 3300046529 Bacteria 7768
105 Ga0495640_0030909 3300046533 Bacteria 3829
106 Ga0495640_0063213 3300046533 Bacteria 2508
107 Ga0495586_0000271 3300046535 Bacteria 33410
108 Ga0495586_0024666 3300046535 Bacteria 3216
109 Ga0495586_0103661 3300046535 Bacteria 1580
110 Ga0495645_0032245 3300046543 Bacteria 3821
111 Ga0495645_0154079 3300046543 Bacteria 1594
112 Ga0495645_0277936 3300046543 Bacteria 1102
113 Ga0495667_0006839 3300046559 Bacteria 7741
114 Ga0495667_0184298 3300046559 Bacteria 1339
115 Ga0495634_0073545 3300046642 Bacteria 2247
116 Ga0495657_0055651 3300046675 Bacteria 2638
117 Ga0495599_0032258 3300046678 Bacteria 3289
118 Ga0495647_0065944 3300046681 Bacteria 1439
119 Ga0495658_0019229 3300046683 Bacteria 3562
120 Ga0495658_0039483 3300046683 Bacteria 2619
121 Ga0495613_0055174 3300046689 Bacteria 2920
122 Ga0495613_0330176 3300046689 Bacteria 1051
123 Ga0495581_0055811 3300047315 Bacteria 2280
124 Ga0495581_0070834 3300047315 Bacteria 2017
125 Ga0495674_0000767 3300047319 Bacteria 30476
126 Ga0495674_0023344 3300047319 Bacteria 5702
127 Ga0495674_0080331 3300047319 Bacteria 2799
128 Ga0496102_0000045 3300048905 Bacteria 186726
129 Ga0496103_0000050 3300048906 Bacteria 152034
130 Ga0496114_0000003 3300048917 Bacteria 630981
131 Ga0496115_0016151 3300048918 Bacteria 5678
132 Ga0496118_0194976 3300048921 Bacteria 1207
133 Ga0496125_0145702 3300048928 Bacteria 1637
134 Ga0501034_0440758 3300049571 Bacteria 1221
135 Ga0501072_0204122 3300049588 Bacteria 1576
136 nmdc:mga00v17_10616_c1 3300050491 Bacteria 5035
137 nmdc:mga0yw44_63625_c1 3300050492 Bacteria 2269
138 nmdc:mga08y16_171641_c1 3300050511 Bacteria 2252
139 nmdc:mga08y16_296567_c1 3300050511 Bacteria 1666
140 nmdc:mga08y16_364615_c1 3300050511 Bacteria 1483
141 nmdc:mga08y16_460930_c1 3300050511 Bacteria 1295
142 nmdc:mga08y16_63786_c1 3300050511 Bacteria 3848
143 nmdc:mga0n895_12124_c1 3300050512 Bacteria 7714
144 nmdc:mga08x19_126971_c1 3300050514 Bacteria 1713
145 nmdc:mga0a205_76784_c1 3300050515 Bacteria 3228
146 Ga0495655_0000004 3300053083 Bacteria 293683
147 Ga0500628_000004 3300053129 Bacteria 202098
148 Ga0500616_0004931 3300053153 Bacteria 9266
149 Ga0501084_0330154 3300054114 Bacteria 1288

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0079573 Ga0373947_0079573_12_878 288
2 3300048928 Ga0496125_0145702 Ga0496125_0145702_725_1627 289
3 3300005563 Ga0068855_100712945 Ga0068855_1007129451 300
4 3300027907 Ga0207428_10260633 Ga0207428_102606332 309
5 3300028381 Ga0268264_10274653 Ga0268264_102746532 309
6 3300036401 Ga0373937_0221281 Ga0373937_0221281_459_1448 309
7 3300025923 Ga0207681_10176424 Ga0207681_101764242 312
8 3300028380 Ga0268265_10574875 Ga0268265_105748751 312
9 3300005340 Ga0070689_100048405 Ga0070689_1000484051 314
10 3300013307 Ga0157372_10098326 Ga0157372_100983264 314
11 3300025915 Ga0207693_10139352 Ga0207693_101393522 314
12 3300006844 Ga0075428_100017762 Ga0075428_1000177623 315
13 3300028017 Ga0265356_1002581 Ga0265356_10025813 315
14 3300030760 Ga0265762_1002447 Ga0265762_10024472 315
15 3300005330 Ga0070690_100150841 Ga0070690_1001508412 318
16 3300005340 Ga0070689_100022132 Ga0070689_1000221323 318
17 3300009094 Ga0111539_10207766 Ga0111539_102077662 318
18 3300021377 Ga0213874_10023545 Ga0213874_100235452 318
19 3300025936 Ga0207670_10085656 Ga0207670_100856561 318
20 3300039450 Ga0436363_1386368 Ga0436363_1386368_460_1443 318
21 3300047315 Ga0495581_0055811 Ga0495581_0055811_1170_2165 318
22 3300049571 Ga0501034_0440758 Ga0501034_0440758_136_1128 318
23 3300050511 nmdc:mga08y16_171641_c1 nmdc:mga08y16_171641_c1_275_1270 318
24 3300050514 nmdc:mga08x19_126971_c1 nmdc:mga08x19_126971_c1_497_1492 318
25 3300005340 Ga0070689_100016431 Ga0070689_1000164313 319
26 3300025936 Ga0207670_10028541 Ga0207670_100285412 319
27 3300028573 Ga0265334_10004775 Ga0265334_100047753 319
28 3300046516 Ga0495628_0000789 Ga0495628_0000789_23794_24786 319
29 3300046543 Ga0495645_0032245 Ga0495645_0032245_2427_3419 319
30 3300046683 Ga0495658_0019229 Ga0495658_0019229_1024_2013 319
31 3300005617 Ga0068859_100189515 Ga0068859_1001895151 320
32 3300006931 Ga0097620_100189515 Ga0097620_1001895151 320
33 3300021384 Ga0213876_10000851 Ga0213876_100008518 320
34 3300039437 Ga0436365_0413769 Ga0436365_0413769_26792_27781 320
35 3300046529 Ga0495652_0012182 Ga0495652_0012182_5962_6948 321
36 3300046535 Ga0495586_0024666 Ga0495586_0024666_753_1739 321
37 3300046642 Ga0495634_0073545 Ga0495634_0073545_429_1415 321
38 3300046683 Ga0495658_0039483 Ga0495658_0039483_1172_2158 321
39 3300046689 Ga0495613_0055174 Ga0495613_0055174_935_1921 321
40 3300006844 Ga0075428_100070591 Ga0075428_1000705913 322
41 3300006846 Ga0075430_100266914 Ga0075430_1002669141 322
42 3300006847 Ga0075431_100004630 Ga0075431_1000046304 322
43 3300006871 Ga0075434_100070693 Ga0075434_1000706932 322
44 3300025916 Ga0207663_10207749 Ga0207663_102077491 322
45 3300035692 Ga0373935_0101692 Ga0373935_0101692_63_1082 322
46 3300046454 Ga0495592_0028463 Ga0495592_0028463_2543_3532 322
47 3300046517 Ga0495630_0012668 Ga0495630_0012668_2713_3732 322
48 3300046543 Ga0495645_0277936 Ga0495645_0277936_50_1039 322
49 3300046559 Ga0495667_0184298 Ga0495667_0184298_275_1264 322
50 3300046678 Ga0495599_0032258 Ga0495599_0032258_120_1139 322
51 3300047319 Ga0495674_0023344 Ga0495674_0023344_1739_2728 322
52 3300049588 Ga0501072_0204122 Ga0501072_0204122_577_1545 322
53 3300050512 nmdc:mga0n895_12124_c1 nmdc:mga0n895_12124_c1_2752_3741 322
54 3300050515 nmdc:mga0a205_76784_c1 nmdc:mga0a205_76784_c1_1656_2645 322
55 3300054114 Ga0501084_0330154 Ga0501084_0330154_83_1051 322
56 3300028800 Ga0265338_10001410 Ga0265338_1000141015 323
57 3300029957 Ga0265324_10004333 Ga0265324_100043335 323
58 3300031249 Ga0265339_10036896 Ga0265339_100368961 323
59 3300046675 Ga0495657_0055651 Ga0495657_0055651_479_1468 323
60 3300006038 Ga0075365_10000493 Ga0075365_100004935 326
61 3300006038 Ga0075365_10043041 Ga0075365_100430413 326
62 3300006051 Ga0075364_10002586 Ga0075364_100025864 326
63 3300050491 nmdc:mga00v17_10616_c1 nmdc:mga00v17_10616_c1_2962_3945 326
64 3300050492 nmdc:mga0yw44_63625_c1 nmdc:mga0yw44_63625_c1_900_1883 326
65 3300005327 Ga0070658_10001371 Ga0070658_100013717 327
66 3300006844 Ga0075428_100556724 Ga0075428_1005567241 327
67 3300009545 Ga0105237_10002879 Ga0105237_100028798 327
68 3300025909 Ga0207705_10004316 Ga0207705_100043166 327
69 3300025914 Ga0207671_10093977 Ga0207671_100939772 327
70 3300046511 Ga0495608_0006290 Ga0495608_0006290_4401_5396 327
71 3300046543 Ga0495645_0154079 Ga0495645_0154079_34_1026 327
72 3300046559 Ga0495667_0006839 Ga0495667_0006839_1973_2968 327
73 3300050511 nmdc:mga08y16_296567_c1 nmdc:mga08y16_296567_c1_268_1263 327
74 3300050511 nmdc:mga08y16_364615_c1 nmdc:mga08y16_364615_c1_462_1457 327
75 3300053153 Ga0500616_0004931 Ga0500616_0004931_5360_6346 327
76 3300003659 JGI25404J52841_10007596 JGI25404J52841_100075962 328
77 3300005340 Ga0070689_100052157 Ga0070689_1000521572 328
78 3300005340 Ga0070689_100107836 Ga0070689_1001078363 328
79 3300005343 Ga0070687_100123140 Ga0070687_1001231401 328
80 3300005365 Ga0070688_100055880 Ga0070688_1000558803 328
81 3300005439 Ga0070711_100085307 Ga0070711_1000853072 328
82 3300005444 Ga0070694_100017042 Ga0070694_1000170423 328
83 3300005445 Ga0070708_100141448 Ga0070708_1001414482 328
84 3300005549 Ga0070704_100001090 Ga0070704_1000010903 328
85 3300005563 Ga0068855_100128960 Ga0068855_1001289604 328
86 3300005841 Ga0068863_100041131 Ga0068863_1000411313 328
87 3300005981 Ga0081538_10000023 Ga0081538_1000002332 328
88 3300005983 Ga0081540_1000358 Ga0081540_100035821 328
89 3300009094 Ga0111539_10079741 Ga0111539_100797413 328
90 3300009094 Ga0111539_10302253 Ga0111539_103022532 328
91 3300013104 Ga0157370_10103542 Ga0157370_101035422 328
92 3300021388 Ga0213875_10000086 Ga0213875_1000008621 328
93 3300025916 Ga0207663_10068043 Ga0207663_100680432 328
94 3300025918 Ga0207662_10025826 Ga0207662_100258261 328
95 3300025936 Ga0207670_10005487 Ga0207670_100054876 328
96 3300025949 Ga0207667_10098330 Ga0207667_100983301 328
97 3300026078 Ga0207702_10004230 Ga0207702_100042309 328
98 3300026088 Ga0207641_10004274 Ga0207641_100042743 328
99 3300026088 Ga0207641_10022583 Ga0207641_100225835 328
100 3300027907 Ga0207428_10106611 Ga0207428_101066112 328
101 3300028556 Ga0265337_1000109 Ga0265337_10001092 328
102 3300028558 Ga0265326_10014378 Ga0265326_100143782 328
103 3300028666 Ga0265336_10010597 Ga0265336_100105973 328
104 3300028800 Ga0265338_10006950 Ga0265338_1000695012 328
105 3300028800 Ga0265338_10025937 Ga0265338_100259371 328
106 3300029957 Ga0265324_10000382 Ga0265324_1000038217 328
107 3300031251 Ga0265327_10024269 Ga0265327_100242692 328
108 3300035084 Ga0373928_0000932 Ga0373928_0000932_1633_2628 328
109 3300035085 Ga0373929_0001750 Ga0373929_0001750_1644_2639 328
110 3300035089 Ga0373944_0000013 Ga0373944_0000013_22445_23440 328
111 3300035090 Ga0373949_0001926 Ga0373949_0001926_2913_3908 328
112 3300035091 Ga0373951_0003243 Ga0373951_0003243_178_1173 328
113 3300035112 Ga0373932_0000001 Ga0373932_0000001_1187144_1188139 328
114 3300035116 Ga0373945_0010213 Ga0373945_0010213_1554_2549 328
115 3300035119 Ga0373956_0007492 Ga0373956_0007492_3040_4035 328
116 3300035242 Ga0373962_0000043 Ga0373962_0000043_2103_3098 328
117 3300035691 Ga0373931_0000002 Ga0373931_0000002_307259_308254 328
118 3300035695 Ga0373927_0005241 Ga0373927_0005241_5639_6634 328
119 3300035725 Ga0373947_0014734 Ga0373947_0014734_912_1907 328
120 3300037068 Ga0373925_0000352 Ga0373925_0000352_1771_2766 328
121 3300037068 Ga0373925_0002072 Ga0373925_0002072_9909_10904 328
122 3300037853 Ga0436364_0985190 Ga0436364_0985190_15478_16464 328
123 3300042876 Ga0451577_0024977 Ga0451577_0024977_982_2001 328
124 3300044712 Ga0453684_0199704 Ga0453684_0199704_559_1551 328
125 3300045051 Ga0451576_0053338 Ga0451576_0053338_1490_2482 328
126 3300045051 Ga0451576_0069311 Ga0451576_0069311_2516_3514 328
127 3300045051 Ga0451576_0244431 Ga0451576_0244431_270_1259 328
128 3300046473 Ga0495582_0048723 Ga0495582_0048723_614_1603 328
129 3300046476 Ga0495662_0089225 Ga0495662_0089225_379_1368 328
130 3300046517 Ga0495630_0000305 Ga0495630_0000305_27239_28228 328
131 3300046526 Ga0495666_0023723 Ga0495666_0023723_223_1221 328
132 3300046533 Ga0495640_0030909 Ga0495640_0030909_1900_2889 328
133 3300046533 Ga0495640_0063213 Ga0495640_0063213_639_1634 328
134 3300046535 Ga0495586_0000271 Ga0495586_0000271_27259_28248 328
135 3300046535 Ga0495586_0103661 Ga0495586_0103661_132_1121 328
136 3300046681 Ga0495647_0065944 Ga0495647_0065944_400_1392 328
137 3300046689 Ga0495613_0330176 Ga0495613_0330176_47_1036 328
138 3300047315 Ga0495581_0070834 Ga0495581_0070834_728_1717 328
139 3300047319 Ga0495674_0000767 Ga0495674_0000767_7153_8142 328
140 3300047319 Ga0495674_0080331 Ga0495674_0080331_941_1936 328
141 3300048905 Ga0496102_0000045 Ga0496102_0000045_74618_75604 328
142 3300048906 Ga0496103_0000050 Ga0496103_0000050_76429_77415 328
143 3300048917 Ga0496114_0000003 Ga0496114_0000003_129190_130176 328
144 3300048918 Ga0496115_0016151 Ga0496115_0016151_70_1056 328
145 3300048921 Ga0496118_0194976 Ga0496118_0194976_171_1157 328
146 3300050511 nmdc:mga08y16_460930_c1 nmdc:mga08y16_460930_c1_137_1126 328
147 3300050511 nmdc:mga08y16_63786_c1 nmdc:mga08y16_63786_c1_1504_2496 328
148 3300053083 Ga0495655_0000004 Ga0495655_0000004_153093_154079 328
149 3300053129 Ga0500628_000004 Ga0500628_000004_61508_62494 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02866

Ldh_1_C

lactate/malate dehydrogenase, alpha/beta C-terminal domain

173

343

0.95

PF00056

Ldh_1_N

lactate/malate dehydrogenase, NAD binding domain

22

169

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tvo-assembly1.cif.gz_B structure of malate dehydrogenase from mycobacterium tuberculosis 0.9951 3 328
4tvo-assembly1.cif.gz_B structure of malate dehydrogenase from mycobacterium tuberculosis 0.9919 3 328
3d5t-assembly2.cif.gz_D crystal structure of malate dehydrogenase from burkholderia pseudomallei 0.9896 2 324
3d5t-assembly2.cif.gz_C crystal structure of malate dehydrogenase from burkholderia pseudomallei 0.9888 2 324
1bdm-assembly1.cif.gz_A the structure at 1.8 angstroms resolution of a single site mutant (t189i) of malate dehydrogenase from thermus flavus with increased enzymatic activity 0.9877 1 328
ID Description Score Start End Superfamily
3d5tB02 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9838 155 323 3.90.110.10
af_Q4D123_7_158_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9836 5 148 3.40.50.720
4uuoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9775 3 151 3.40.50.720
7mdhC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9743 2 148 3.40.50.720
af_A0A1D6GPH0_156_306_3.90.110.10 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9704 155 301 3.90.110.10
ID Description Score Start End GO Terms
AF-A0A7K2EB87-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 1.003 2 80 GO:0006108
GO:0030060
AF-A0A6M1ZFR5-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 1.003 3 84 GO:0006108
GO:0030060
AF-A0A7Y6HZS5-F1-model_v4 deleted 1.002 244 328
AF-L7VQR7-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 0.9987 155 328 GO:0006108
GO:0030060
AF-A0A538A8P8-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 0.9986 204 328 GO:0006108
GO:0030060

Feature Viewer

pLDDT pTM Quality
95.16 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map