F207672
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 150 | 113 | 300 | 428 |
Family's Representative Sequence
| Representative Sequence | 3300003763|Ga0055529_1001082|Ga0055529_10010822 |
| Length | 485 |
| Sequence | MLYSHSVATKQYKQLHLLTYSKKKRYLPIICNRLQLAYTTHWETRKNMNSTLLRGVLVGGLAGLLFGFDTAVIAGTTQGLSAAFHLDPAALGWTVSSALWGTLIGALVAGLPGDAFGARNCLRVIALMYVASGIGSFCATSLPVLIAARVLGGLAIGASSVLAPTYLAEIAPARMRGALVGMFQLNIVFGILVAYLSNYLIGTLDLGDAEWRWKFGVTILPSLILWLLLYTIPNSPRWLAVKDRLDEARKVLRQIGVPQPDTELALYQRQHLEHKGVKVRLSWKAYARPMLLAIAIAGFNQLSGINAILYYLNDIFAAAGFAKVSADLQSVIIGATNLAFTLLALTVIDRAGRKTLLLIGSVGLVISLAGTAFIQLTSTHQNYLLWMLILFIASFAFSQGAVIWVYIAEIFPTEVRSRGQGLGASTHWFMDAVIATAFPLVAAYSKGLPFVFFAAAMAVQFLVVLKFFPETKGATLEEIHLGGKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 20 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 21 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 23 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 31 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 32 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 33 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 34 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 49 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 51 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 52 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 53 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 54 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 55 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 56 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 57 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 58 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 59 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 60 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 61 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 62 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 63 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 64 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 65 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 66 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 67 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 68 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 69 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 70 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 71 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 72 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 73 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 74 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 75 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 76 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 77 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 78 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 79 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 80 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 91 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 92 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 93 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 94 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 95 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 96 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 98 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 99 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 100 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 102 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 103 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 104 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 105 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 106 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 107 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 108 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 109 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 110 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 111 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 112 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 113 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.67 |
| Metatranscriptomes | 0.67 |
| Isolates | 2.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6 |
| Nodule | 0 |
| Rhizoplane | 3.33 |
| Rhizosphere | 76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055529_1001082 | 3300003763 | Bacteria | 12469 |
| 2 | JGI24735J21928_10003085 | 3300002067 | Bacteria | 5704 |
| 3 | rootH2_10003244 | 3300003320 | Bacteria | 3966 |
| 4 | rootH2_10012842 | 3300003320 | Bacteria | 4615 |
| 5 | rootH2_10013843 | 3300003320 | Bacteria | 5404 |
| 6 | rootH2_10069138 | 3300003320 | Bacteria | 7675 |
| 7 | rootL2_10093470 | 3300003322 | Bacteria | 9372 |
| 8 | rootH1_10001020 | 3300003323 | Bacteria | 28506 |
| 9 | rootH1_10007718 | 3300003323 | Bacteria | 5310 |
| 10 | rootH1_10104213 | 3300003323 | Bacteria | 2913 |
| 11 | rootH1_10214340 | 3300003323 | Bacteria | 2229 |
| 12 | Ga0070658_10000221 | 3300005327 | Bacteria | 50678 |
| 13 | Ga0070677_10036441 | 3300005333 | Bacteria | 1913 |
| 14 | Ga0070660_100000337 | 3300005339 | Bacteria | 31136 |
| 15 | Ga0070660_100013707 | 3300005339 | Bacteria | 5827 |
| 16 | Ga0070659_100039219 | 3300005366 | Bacteria | 3697 |
| 17 | Ga0070709_10062056 | 3300005434 | Unclassified | 2382 |
| 18 | Ga0070701_10024836 | 3300005438 | Bacteria | 2903 |
| 19 | Ga0070711_100111085 | 3300005439 | Bacteria | 2012 |
| 20 | Ga0070711_100149552 | 3300005439 | Bacteria | 1759 |
| 21 | Ga0070678_100059859 | 3300005456 | Bacteria | 2800 |
| 22 | Ga0070679_100012120 | 3300005530 | Bacteria | 8236 |
| 23 | Ga0070693_100077882 | 3300005547 | Bacteria | 1969 |
| 24 | Ga0070665_100027825 | 3300005548 | Bacteria | 5693 |
| 25 | Ga0068855_100007300 | 3300005563 | Bacteria | 13385 |
| 26 | Ga0068855_100234722 | 3300005563 | Unclassified | 2052 |
| 27 | Ga0068856_100000208 | 3300005614 | Bacteria | 63132 |
| 28 | Ga0068861_100009783 | 3300005719 | Bacteria | 6629 |
| 29 | Ga0081455_10003315 | 3300005937 | Bacteria | 18615 |
| 30 | Ga0070716_100000271 | 3300006173 | Bacteria | 20855 |
| 31 | Ga0075370_10019515 | 3300006353 | Bacteria | 3694 |
| 32 | Ga0105240_10060171 | 3300009093 | Bacteria | 4736 |
| 33 | Ga0105237_10118464 | 3300009545 | Bacteria | 2642 |
| 34 | Ga0105239_10018672 | 3300010375 | Bacteria | 7659 |
| 35 | Ga0157370_10002005 | 3300013104 | Bacteria | 25033 |
| 36 | Ga0157369_10005920 | 3300013105 | Bacteria | 14200 |
| 37 | Ga0157369_10058397 | 3300013105 | Bacteria | 4162 |
| 38 | Ga0157374_10001785 | 3300013296 | Bacteria | 18097 |
| 39 | Ga0157375_10094152 | 3300013308 | Unclassified | 3063 |
| 40 | Ga0183365_10008 | 3300015684 | Bacteria | 74681 |
| 41 | Ga0209437_103912 | 3300025233 | Bacteria | 2649 |
| 42 | Ga0209026_1002114 | 3300025250 | Bacteria | 7781 |
| 43 | Ga0209455_1000044 | 3300025272 | Bacteria | 410787 |
| 44 | Ga0207705_10000100 | 3300025909 | Bacteria | 102196 |
| 45 | Ga0207705_10104886 | 3300025909 | Bacteria | 2083 |
| 46 | Ga0207695_10051542 | 3300025913 | Bacteria | 4320 |
| 47 | Ga0207662_10011419 | 3300025918 | Bacteria | 4926 |
| 48 | Ga0207657_10000642 | 3300025919 | Bacteria | 37108 |
| 49 | Ga0207657_10002186 | 3300025919 | Bacteria | 21186 |
| 50 | Ga0207649_10035936 | 3300025920 | Bacteria | 2981 |
| 51 | Ga0207652_10036430 | 3300025921 | Bacteria | 4159 |
| 52 | Ga0207665_10000015 | 3300025939 | Bacteria | 133147 |
| 53 | Ga0207691_10009377 | 3300025940 | Bacteria | 9398 |
| 54 | Ga0207691_10025083 | 3300025940 | Bacteria | 5600 |
| 55 | Ga0207679_10118998 | 3300025945 | Bacteria | 2099 |
| 56 | Ga0207678_10025426 | 3300026067 | Bacteria | 5168 |
| 57 | Ga0207678_10198420 | 3300026067 | Bacteria | 1715 |
| 58 | Ga0207702_10053302 | 3300026078 | Bacteria | 3424 |
| 59 | Ga0207675_100005368 | 3300026118 | Bacteria | 12299 |
| 60 | Ga0207683_10018066 | 3300026121 | Bacteria | 6014 |
| 61 | Ga0209970_1005101 | 3300027614 | Bacteria | 2170 |
| 62 | Ga0265354_1000849 | 3300028016 | Bacteria | 4920 |
| 63 | Ga0268266_10015486 | 3300028379 | Bacteria | 6543 |
| 64 | Ga0307515_10001513 | 3300028794 | Bacteria | 52028 |
| 65 | Ga0307515_10026085 | 3300028794 | Bacteria | 10075 |
| 66 | Ga0307515_10168678 | 3300028794 | Unclassified | 2194 |
| 67 | Ga0265760_10006467 | 3300031090 | Bacteria | 3350 |
| 68 | Ga0307513_10211156 | 3300031456 | Bacteria | 1772 |
| 69 | Ga0307408_100022966 | 3300031548 | Bacteria | 4245 |
| 70 | Ga0307405_10053642 | 3300031731 | Bacteria | 2513 |
| 71 | Ga0307413_10032825 | 3300031824 | Bacteria | 2947 |
| 72 | Ga0307410_10008761 | 3300031852 | Bacteria | 5632 |
| 73 | Ga0307410_10151187 | 3300031852 | Unclassified | 1729 |
| 74 | Ga0307406_10009193 | 3300031901 | Bacteria | 5536 |
| 75 | Ga0307407_10019795 | 3300031903 | Bacteria | 3434 |
| 76 | Ga0307407_10055703 | 3300031903 | Bacteria | 2286 |
| 77 | Ga0307412_10002323 | 3300031911 | Bacteria | 10524 |
| 78 | Ga0307409_100001729 | 3300031995 | Bacteria | 11012 |
| 79 | Ga0307409_100050998 | 3300031995 | Bacteria | 3164 |
| 80 | Ga0307416_100039859 | 3300032002 | Bacteria | 3642 |
| 81 | Ga0307416_100115161 | 3300032002 | Bacteria | 2380 |
| 82 | Ga0307411_10024707 | 3300032005 | Bacteria | 3586 |
| 83 | Ga0307510_10031625 | 3300033180 | Bacteria | 5975 |
| 84 | Ga0395899_0000456 | 3300037312 | Bacteria | 46281 |
| 85 | Ga0395899_0000669 | 3300037312 | Bacteria | 34717 |
| 86 | Ga0395899_0004531 | 3300037312 | Bacteria | 10827 |
| 87 | Ga0395899_0011914 | 3300037312 | Bacteria | 6660 |
| 88 | Ga0395900_0001777 | 3300037418 | Bacteria | 24746 |
| 89 | Ga0395900_0002797 | 3300037418 | Bacteria | 19062 |
| 90 | Ga0395900_0014853 | 3300037418 | Bacteria | 7936 |
| 91 | Ga0395900_0175523 | 3300037418 | Bacteria | 2179 |
| 92 | Ga0395898_0000315 | 3300037466 | Bacteria | 111811 |
| 93 | Ga0395898_0010753 | 3300037466 | Bacteria | 9559 |
| 94 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 95 | Ga0395905_0008715 | 3300037471 | Bacteria | 9982 |
| 96 | Ga0395905_0192487 | 3300037471 | Unclassified | 1913 |
| 97 | Ga0395901_0006179 | 3300038443 | Bacteria | 12137 |
| 98 | Ga0395901_0212636 | 3300038443 | Bacteria | 2023 |
| 99 | Ga0451791_1927725 | 3300041451 | Bacteria | 3985 |
| 100 | Ga0451797_0123059 | 3300041453 | Bacteria | 1842 |
| 101 | Ga0451807_0340413 | 3300041486 | Bacteria | 2755 |
| 102 | Ga0466969_0000231 | 3300044656 | Bacteria | 30436 |
| 103 | Ga0466966_0000982 | 3300044684 | Bacteria | 18280 |
| 104 | Ga0466961_0012243 | 3300044693 | Bacteria | 5485 |
| 105 | Ga0466971_0003423 | 3300044719 | Bacteria | 6783 |
| 106 | Ga0466970_0002588 | 3300044765 | Bacteria | 8717 |
| 107 | Ga0466957_0038414 | 3300044842 | Bacteria | 2884 |
| 108 | Ga0466959_0012413 | 3300045049 | Bacteria | 6155 |
| 109 | Ga0466958_0009098 | 3300045836 | Bacteria | 5520 |
| 110 | Ga0495638_0007577 | 3300046460 | Bacteria | 7766 |
| 111 | Ga0495606_0010626 | 3300046507 | Bacteria | 7618 |
| 112 | Ga0495610_0001973 | 3300046512 | Bacteria | 17567 |
| 113 | Ga0495610_0004465 | 3300046512 | Bacteria | 10332 |
| 114 | Ga0495637_0009476 | 3300046520 | Bacteria | 4748 |
| 115 | Ga0495648_0013279 | 3300046524 | Bacteria | 6100 |
| 116 | Ga0495633_0011421 | 3300046558 | Bacteria | 4790 |
| 117 | Ga0495649_0012684 | 3300046694 | Bacteria | 4889 |
| 118 | Ga0495681_0000047 | 3300047470 | Bacteria | 110934 |
| 119 | Ga0495686_0000944 | 3300047472 | Bacteria | 36054 |
| 120 | Ga0495686_0005003 | 3300047472 | Bacteria | 10645 |
| 121 | Ga0495686_0005024 | 3300047472 | Bacteria | 10621 |
| 122 | Ga0495686_0070673 | 3300047472 | Bacteria | 2150 |
| 123 | Ga0495626_0000681 | 3300048091 | Bacteria | 32537 |
| 124 | Ga0496112_0010566 | 3300048915 | Bacteria | 8384 |
| 125 | Ga0496113_0009689 | 3300048916 | Bacteria | 6327 |
| 126 | Ga0496120_0031795 | 3300048923 | Bacteria | 3190 |
| 127 | Ga0496121_0008291 | 3300048924 | Bacteria | 12289 |
| 128 | Ga0496124_0001405 | 3300048927 | Bacteria | 35949 |
| 129 | Ga0496124_0002692 | 3300048927 | Bacteria | 22733 |
| 130 | Ga0496126_0009727 | 3300048929 | Bacteria | 10187 |
| 131 | Ga0495678_023170 | 3300049459 | Bacteria | 2705 |
| 132 | Ga0501034_0346552 | 3300049571 | Bacteria | 1415 |
| 133 | Ga0501040_0012729 | 3300049576 | Bacteria | 5520 |
| 134 | Ga0501041_0020632 | 3300049577 | Bacteria | 3941 |
| 135 | Ga0501046_0074541 | 3300049580 | Bacteria | 2633 |
| 136 | Ga0501075_0052851 | 3300049591 | Bacteria | 3055 |
| 137 | Ga0501080_0049481 | 3300049742 | Bacteria | 3912 |
| 138 | Ga0501080_0183110 | 3300049742 | Bacteria | 1927 |
| 139 | Ga0501035_0019929 | 3300049822 | Bacteria | 6161 |
| 140 | Ga0501035_0086723 | 3300049822 | Bacteria | 2758 |
| 141 | nmdc:mga07m45_31795_c1 | 3300050496 | Bacteria | 2924 |
| 142 | Ga0500635_0000760 | 3300053080 | Bacteria | 8033 |
| 143 | Ga0500608_000718 | 3300053122 | Bacteria | 12157 |
| 144 | Ga0500622_0039644 | 3300053156 | Bacteria | 2455 |
| 145 | Ga0500624_000021 | 3300053157 | Bacteria | 117511 |
| 146 | Ga0466962_0000395 | 3300061719 | Bacteria | 18868 |
| 147 | 2819555450 | 2818991438 | Bacteria | 5793701 |
| 148 | 2884217152 | 2884215851 | Bacteria | 4554841 |
| 149 | 2919140608 | 2919138771 | Bacteria | 5281312 |
| 150 | 8054304626 | 8054302542 | Bacteria | 5698134 |
| 151 | Ga0055529_1001082 | |||
| 152 | JGI24735J21928_10003085 | |||
| 153 | rootH2_10003244 | |||
| 154 | rootH2_10012842 | |||
| 155 | rootH2_10013843 | |||
| 156 | rootH2_10069138 | |||
| 157 | rootL2_10093470 | |||
| 158 | rootH1_10001020 | |||
| 159 | rootH1_10007718 | |||
| 160 | rootH1_10104213 | |||
| 161 | rootH1_10214340 | |||
| 162 | Ga0070658_10000221 | |||
| 163 | Ga0070677_10036441 | |||
| 164 | Ga0070660_100000337 | |||
| 165 | Ga0070660_100013707 | |||
| 166 | Ga0070659_100039219 | |||
| 167 | Ga0070709_10062056 | |||
| 168 | Ga0070701_10024836 | |||
| 169 | Ga0070711_100111085 | |||
| 170 | Ga0070711_100149552 | |||
| 171 | Ga0070678_100059859 | |||
| 172 | Ga0070679_100012120 | |||
| 173 | Ga0070693_100077882 | |||
| 174 | Ga0070665_100027825 | |||
| 175 | Ga0068855_100007300 | |||
| 176 | Ga0068855_100234722 | |||
| 177 | Ga0068856_100000208 | |||
| 178 | Ga0068861_100009783 | |||
| 179 | Ga0081455_10003315 | |||
| 180 | Ga0070716_100000271 | |||
| 181 | Ga0075370_10019515 | |||
| 182 | Ga0105240_10060171 | |||
| 183 | Ga0105237_10118464 | |||
| 184 | Ga0105239_10018672 | |||
| 185 | Ga0157370_10002005 | |||
| 186 | Ga0157369_10005920 | |||
| 187 | Ga0157369_10058397 | |||
| 188 | Ga0157374_10001785 | |||
| 189 | Ga0157375_10094152 | |||
| 190 | Ga0183365_10008 | |||
| 191 | Ga0209437_103912 | |||
| 192 | Ga0209026_1002114 | |||
| 193 | Ga0209455_1000044 | |||
| 194 | Ga0207705_10000100 | |||
| 195 | Ga0207705_10104886 | |||
| 196 | Ga0207695_10051542 | |||
| 197 | Ga0207662_10011419 | |||
| 198 | Ga0207657_10000642 | |||
| 199 | Ga0207657_10002186 | |||
| 200 | Ga0207649_10035936 | |||
| 201 | Ga0207652_10036430 | |||
| 202 | Ga0207665_10000015 | |||
| 203 | Ga0207691_10009377 | |||
| 204 | Ga0207691_10025083 | |||
| 205 | Ga0207679_10118998 | |||
| 206 | Ga0207678_10025426 | |||
| 207 | Ga0207678_10198420 | |||
| 208 | Ga0207702_10053302 | |||
| 209 | Ga0207675_100005368 | |||
| 210 | Ga0207683_10018066 | |||
| 211 | Ga0209970_1005101 | |||
| 212 | Ga0265354_1000849 | |||
| 213 | Ga0268266_10015486 | |||
| 214 | Ga0307515_10001513 | |||
| 215 | Ga0307515_10026085 | |||
| 216 | Ga0307515_10168678 | |||
| 217 | Ga0265760_10006467 | |||
| 218 | Ga0307513_10211156 | |||
| 219 | Ga0307408_100022966 | |||
| 220 | Ga0307405_10053642 | |||
| 221 | Ga0307413_10032825 | |||
| 222 | Ga0307410_10008761 | |||
| 223 | Ga0307410_10151187 | |||
| 224 | Ga0307406_10009193 | |||
| 225 | Ga0307407_10019795 | |||
| 226 | Ga0307407_10055703 | |||
| 227 | Ga0307412_10002323 | |||
| 228 | Ga0307409_100001729 | |||
| 229 | Ga0307409_100050998 | |||
| 230 | Ga0307416_100039859 | |||
| 231 | Ga0307416_100115161 | |||
| 232 | Ga0307411_10024707 | |||
| 233 | Ga0307510_10031625 | |||
| 234 | Ga0395899_0000456 | |||
| 235 | Ga0395899_0000669 | |||
| 236 | Ga0395899_0004531 | |||
| 237 | Ga0395899_0011914 | |||
| 238 | Ga0395900_0001777 | |||
| 239 | Ga0395900_0002797 | |||
| 240 | Ga0395900_0014853 | |||
| 241 | Ga0395900_0175523 | |||
| 242 | Ga0395898_0000315 | |||
| 243 | Ga0395898_0010753 | |||
| 244 | Ga0395905_0000005 | |||
| 245 | Ga0395905_0008715 | |||
| 246 | Ga0395905_0192487 | |||
| 247 | Ga0395901_0006179 | |||
| 248 | Ga0395901_0212636 | |||
| 249 | Ga0451791_1927725 | |||
| 250 | Ga0451797_0123059 | |||
| 251 | Ga0451807_0340413 | |||
| 252 | Ga0466969_0000231 | |||
| 253 | Ga0466966_0000982 | |||
| 254 | Ga0466961_0012243 | |||
| 255 | Ga0466971_0003423 | |||
| 256 | Ga0466970_0002588 | |||
| 257 | Ga0466957_0038414 | |||
| 258 | Ga0466959_0012413 | |||
| 259 | Ga0466958_0009098 | |||
| 260 | Ga0495638_0007577 | |||
| 261 | Ga0495606_0010626 | |||
| 262 | Ga0495610_0001973 | |||
| 263 | Ga0495610_0004465 | |||
| 264 | Ga0495637_0009476 | |||
| 265 | Ga0495648_0013279 | |||
| 266 | Ga0495633_0011421 | |||
| 267 | Ga0495649_0012684 | |||
| 268 | Ga0495681_0000047 | |||
| 269 | Ga0495686_0000944 | |||
| 270 | Ga0495686_0005003 | |||
| 271 | Ga0495686_0005024 | |||
| 272 | Ga0495686_0070673 | |||
| 273 | Ga0495626_0000681 | |||
| 274 | Ga0496112_0010566 | |||
| 275 | Ga0496113_0009689 | |||
| 276 | Ga0496120_0031795 | |||
| 277 | Ga0496121_0008291 | |||
| 278 | Ga0496124_0001405 | |||
| 279 | Ga0496124_0002692 | |||
| 280 | Ga0496126_0009727 | |||
| 281 | Ga0495678_023170 | |||
| 282 | Ga0501034_0346552 | |||
| 283 | Ga0501040_0012729 | |||
| 284 | Ga0501041_0020632 | |||
| 285 | Ga0501046_0074541 | |||
| 286 | Ga0501075_0052851 | |||
| 287 | Ga0501080_0049481 | |||
| 288 | Ga0501080_0183110 | |||
| 289 | Ga0501035_0019929 | |||
| 290 | Ga0501035_0086723 | |||
| 291 | nmdc:mga07m45_31795_c1 | |||
| 292 | Ga0500635_0000760 | |||
| 293 | Ga0500608_000718 | |||
| 294 | Ga0500622_0039644 | |||
| 295 | Ga0500624_000021 | |||
| 296 | Ga0466962_0000395 | |||
| 297 | 2819555450 | |||
| 298 | 2884217152 | |||
| 299 | 2919140608 | |||
| 300 | 8054304626 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gby-assembly1.cif.gz_A | the structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose | 0.9047 | 1 | 409 |
| 6n3i-assembly1.cif.gz_A | crystal structure of a double trp xyle mutants (g58w/l315w) | 0.9004 | 1 | 410 |
| 7spt-assembly1.cif.gz_A | crystal structure of exofacial state human glucose transporter glut3 | 0.8896 | 3 | 415 |
| 7sps-assembly2.cif.gz_B | crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 | 0.8883 | 3 | 413 |
| 4gby-assembly1.cif.gz_A | the structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose | 0.886 | 1 | 409 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6LG74_1_148_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9453 | 51 | 198 | 1.20.1250.20 |
| af_Q54UC8_60_259_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9427 | 8 | 199 | 1.20.1250.20 |
| 4ja3A01 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9411 | 8 | 185 | 1.20.1250.20 |
| 4gc0A01 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.94 | 7 | 207 | 1.20.1250.20 |
| af_P41036_15_224_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9355 | 3 | 195 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J7IA87-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.932 | 8 | 217 |
GO:0015144
GO:0015293 GO:0016020 |
| AF-A0A835FNJ7-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.9303 | 2 | 217 |
GO:0015144
GO:0015293 GO:0016020 |
| AF-A0A7S4J2G5-F1-model_v4 | Hexose transporter 1 | 0.9302 | 3 | 214 |
GO:0005366
GO:0016324 |
| AF-A0A5P1FD29-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.9298 | 7 | 216 |
GO:0015144
GO:0015293 GO:0016020 |
| AF-A0A7J8WL38-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.9298 | 1 | 216 |
GO:0015144
GO:0015293 GO:0016020 |