F209808

General Info

Members Datasets Scaffolds Average Seq Length
150 103 131 265

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0039941|Ga0496117_0039941_1917_2753
Length 278
Sequence MFERKEGMTILVTGATGLVGERLVPRLVEAGEDCRILVRPGKTAPAGVQAVEGDLFDPASLANAVTGVSAIVHLAAVFRTQDNDLIWKSNLEGTRSLIAAVKTNAPAARLVMASTSNVYNKNSPRPGRETDAVEPAEAYPASKIAAEEALRESGLNWAVVRFPFVYGDGDGHLEMLPKHLDAFGFHPANRMSTIHHRDIATAMKLALAGTFDRRIVNIADEAPTTIYELVKLVGENMSPSSEPMPNPWHLHVDGSLARSLGFQPTVRTVYQAEQEGLL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
4 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
5 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
6 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
7 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
8 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
9 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
10 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
11 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
12 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
13 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
14 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
15 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
16 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
17 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
18 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
19 2919404418 Luteibacter sp. 3190 Isolate Unclassified
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
78 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
84 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
85 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
86 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
87 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
88 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
89 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
90 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
91 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
92 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
96 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
99 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
100 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
101 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
102 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
103 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.33
Metatranscriptomes 0
Isolates 12.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.67
Nodule 3.33
Rhizoplane 5.33
Rhizosphere 36
Stem 0
Stem Tuber 0
Unclassified 28.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2381925 2162886007 Bacteria 45817
2 JGI25152J39213_1001376 3300002773 Bacteria 10576
3 JGI25152J39213_1016234 3300002773 Bacteria 1443
4 JGI25150J39212_1000423 3300002774 Bacteria 19455
5 JGI25153J46596_10000785 3300003215 Bacteria 19455
6 rootH2_10057517 3300003320 Bacteria 2556
7 Ga0055524_1003832 3300003775 Bacteria 7139
8 Ga0055536_1000156 3300003781 Bacteria 59021
9 Ga0055528_1000926 3300003790 Bacteria 19597
10 Ga0055530_10007197 3300003791 Bacteria 4750
11 Ga0055540_1000794 3300003792 Bacteria 21378
12 Ga0055531_10000121 3300003794 Bacteria 87524
13 Ga0055531_10001083 3300003794 Bacteria 21388
14 Ga0065165_1000001 3300005262 Bacteria 494087
15 Ga0065165_1000526 3300005262 Bacteria 58564
16 Ga0065165_1001468 3300005262 Bacteria 25249
17 Ga0065704_10070189 3300005289 Bacteria 114786
18 Ga0065704_10082726 3300005289 Bacteria 3559
19 Ga0070668_100071812 3300005347 Bacteria 2696
20 Ga0070671_100058841 3300005355 Bacteria 3198
21 Ga0070667_100007128 3300005367 Bacteria 9292
22 Ga0070665_100000686 3300005548 Bacteria 45211
23 Ga0070665_100084934 3300005548 Bacteria 3170
24 Ga0070665_100112636 3300005548 Bacteria 2724
25 Ga0068863_100000980 3300005841 Bacteria 28685
26 Ga0068860_100001156 3300005843 Bacteria 28867
27 Ga0068862_100107961 3300005844 Bacteria 2441
28 Ga0075365_10073543 3300006038 Bacteria 2304
29 Ga0105251_10002713 3300009011 Bacteria 13579
30 Ga0105247_10087880 3300009101 Bacteria 1969
31 Ga0114129_10220685 3300009147 Unclassified 2557
32 Ga0105248_10026552 3300009177 Bacteria 6442
33 Ga0163162_10495055 3300013306 Bacteria 1353
34 Ga0163161_10130526 3300017792 Bacteria 1895
35 Ga0163161_10146270 3300017792 Bacteria 1793
36 Ga0209674_100403 3300025226 Bacteria 21586
37 Ga0207427_104447 3300025231 Bacteria 2359
38 Ga0207425_1000358 3300025245 Bacteria 31539
39 Ga0209129_1003244 3300025258 Bacteria 7230
40 Ga0209129_1005802 3300025258 Bacteria 4216
41 Ga0209673_1001669 3300025273 Bacteria 19004
42 Ga0209676_1000031 3300025292 Bacteria 478976
43 Ga0209676_1000077 3300025292 Bacteria 298831
44 Ga0209025_1000202 3300025294 Bacteria 145750
45 Ga0209564_1001358 3300025295 Bacteria 25759
46 Ga0209758_1000763 3300025297 Bacteria 46387
47 Ga0209050_1000135 3300025298 Bacteria 184020
48 Ga0209050_1002213 3300025298 Bacteria 17453
49 Ga0209050_1024786 3300025298 Bacteria 2062
50 Ga0209256_1001348 3300025299 Bacteria 26052
51 Ga0209051_1001339 3300025303 Bacteria 21403
52 Ga0209257_1000050 3300025304 Bacteria 439325
53 Ga0209257_1002033 3300025304 Bacteria 21569
54 Ga0209257_1040806 3300025304 Bacteria 1382
55 Ga0207713_1029399 3300025735 Unclassified 2462
56 Ga0207681_10010254 3300025923 Bacteria 5737
57 Ga0207650_10016472 3300025925 Bacteria 5167
58 Ga0207711_10002655 3300025941 Bacteria 15808
59 Ga0207711_10252698 3300025941 Bacteria 1619
60 Ga0207668_10195552 3300025972 Bacteria 1606
61 Ga0207658_10003596 3300025986 Bacteria 10953
62 Ga0207641_10000469 3300026088 Bacteria 45572
63 Ga0268266_10000804 3300028379 Bacteria 41628
64 Ga0268266_10120029 3300028379 Bacteria 2339
65 Ga0268266_10294412 3300028379 Bacteria 1512
66 Ga0268264_10036101 3300028381 Bacteria 4069
67 Ga0314311_1050202 3300030733 Unclassified 1703
68 Ga0307405_10001621 3300031731 Bacteria 9573
69 Ga0307405_10132414 3300031731 Bacteria 1725
70 Ga0307413_10005521 3300031824 Bacteria 5656
71 Ga0307410_10062664 3300031852 Bacteria 2549
72 Ga0307414_10000294 3300032004 Bacteria 29187
73 Ga0395905_0008095 3300037471 Bacteria 10383
74 Ga0436361_0244142 3300039447 Bacteria 2423
75 Ga0466968_0010796 3300044735 Bacteria 3548
76 Ga0466957_0000863 3300044842 Bacteria 15558
77 Ga0466957_0087416 3300044842 Bacteria 1949
78 Ga0495627_015371 3300046453 Bacteria 2643
79 Ga0495607_0000019 3300046501 Bacteria 167319
80 Ga0495606_0002356 3300046507 Bacteria 22178
81 Ga0495643_0000035 3300046522 Bacteria 238464
82 Ga0495643_0005795 3300046522 Bacteria 8269
83 Ga0495633_0002579 3300046558 Bacteria 12684
84 Ga0496106_0132969 3300048909 Unclassified 1952
85 Ga0496116_0031796 3300048919 Bacteria 3770
86 Ga0496116_0038254 3300048919 Bacteria 3335
87 Ga0496116_0191719 3300048919 Bacteria 1081
88 Ga0496117_0007548 3300048920 Bacteria 10595
89 Ga0496117_0039941 3300048920 Bacteria 3457
90 Ga0496117_0193700 3300048920 Bacteria 1155
91 Ga0496118_0000343 3300048921 Bacteria 78995
92 Ga0496118_0044535 3300048921 Bacteria 3474
93 Ga0496118_0045147 3300048921 Bacteria 3443
94 Ga0496118_0062691 3300048921 Bacteria 2741
95 Ga0496118_0113505 3300048921 Bacteria 1790
96 Ga0496120_0036837 3300048923 Bacteria 2907
97 Ga0496120_0089761 3300048923 Bacteria 1644
98 Ga0496121_0067735 3300048924 Bacteria 2892
99 Ga0496121_0101185 3300048924 Unclassified 2223
100 Ga0496121_0144844 3300048924 Bacteria 1757
101 Ga0496122_0008964 3300048925 Bacteria 10639
102 Ga0496122_0073401 3300048925 Bacteria 2426
103 Ga0496123_0004205 3300048926 Bacteria 15365
104 Ga0496123_0020635 3300048926 Bacteria 5148
105 Ga0496123_0131727 3300048926 Bacteria 1383
106 Ga0496123_0134661 3300048926 Bacteria 1362
107 Ga0496124_0000220 3300048927 Bacteria 111209
108 Ga0496124_0001047 3300048927 Bacteria 43685
109 Ga0496124_0019718 3300048927 Bacteria 6264
110 Ga0496124_0164581 3300048927 Bacteria 1725
111 Ga0496124_0176338 3300048927 Bacteria 1649
112 Ga0496124_0367714 3300048927 Bacteria 1011
113 Ga0496125_0003030 3300048928 Bacteria 21015
114 Ga0496125_0024850 3300048928 Bacteria 5498
115 Ga0496125_0100693 3300048928 Bacteria 2129
116 Ga0496125_0122861 3300048928 Bacteria 1847
117 Ga0496125_0283027 3300048928 Bacteria 1026
118 Ga0496126_0000243 3300048929 Bacteria 117685
119 Ga0496126_0009054 3300048929 Bacteria 10643
120 Ga0496126_0029975 3300048929 Bacteria 5163
121 Ga0496126_0486592 3300048929 Unclassified 988
122 Ga0501034_0270321 3300049571 Unclassified 1641
123 Ga0501080_0400720 3300049742 Unclassified 1234
124 Ga0501241_000780 3300049758 Bacteria 6740
125 nmdc:mga0yw44_19099_c1 3300050492 Bacteria 3772
126 nmdc:mga05p37_223581_c1 3300050507 Unclassified 2271
127 nmdc:mga0sz30_63278_c1 3300050516 Bacteria 1583
128 Ga0500641_0032129 3300053096 Bacteria 2074
129 Ga0500633_0000554 3300053160 Bacteria 6066
130 Ga0500634_0000010 3300053161 Bacteria 138411
131 Ga0500645_036780 3300053730 Bacteria 1456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0367714 Ga0496124_0367714_17_712 218
2 iso_pu_bacteria 2585427633 2585993528 224
3 3300048924 Ga0496121_0067735 Ga0496121_0067735_2142_2828 228
4 3300025298 Ga0209050_1024786 Ga0209050_10247862 231
5 3300025303 Ga0209051_1001339 Ga0209051_100133920 231
6 3300025304 Ga0209257_1002033 Ga0209257_10020339 231
7 3300048926 Ga0496123_0131727 Ga0496123_0131727_29_724 231
8 3300003792 Ga0055540_1000794 Ga0055540_100079420 235
9 3300003794 Ga0055531_10001083 Ga0055531_100010838 235
10 3300009147 Ga0114129_10220685 Ga0114129_102206852 239
11 3300050507 nmdc:mga05p37_223581_c1 nmdc:mga05p37_223581_c1_172_891 239
12 3300044735 Ga0466968_0010796 Ga0466968_0010796_2797_3522 241
13 3300002773 JGI25152J39213_1001376 JGI25152J39213_10013764 251
14 3300003775 Ga0055524_1003832 Ga0055524_10038327 251
15 3300003790 Ga0055528_1000926 Ga0055528_10009268 251
16 3300025258 Ga0209129_1003244 Ga0209129_10032449 251
17 3300025273 Ga0209673_1001669 Ga0209673_100166928 251
18 3300025295 Ga0209564_1001358 Ga0209564_100135828 251
19 3300025299 Ga0209256_1001348 Ga0209256_100134828 251
20 3300046453 Ga0495627_015371 Ga0495627_015371_233_988 251
21 3300046558 Ga0495633_0002579 Ga0495633_0002579_4192_4947 251
22 3300048919 Ga0496116_0191719 Ga0496116_0191719_217_1032 251
23 3300048925 Ga0496122_0073401 Ga0496122_0073401_1254_2069 251
24 3300048920 Ga0496117_0007548 Ga0496117_0007548_742_1557 258
25 3300048921 Ga0496118_0062691 Ga0496118_0062691_255_1070 258
26 3300048923 Ga0496120_0089761 Ga0496120_0089761_726_1541 258
27 3300048926 Ga0496123_0020635 Ga0496123_0020635_3323_4138 258
28 3300048928 Ga0496125_0122861 Ga0496125_0122861_537_1313 258
29 3300048921 Ga0496118_0044535 Ga0496118_0044535_420_1199 259
30 3300037471 Ga0395905_0008095 Ga0395905_0008095_1769_2551 260
31 iso_pu_bacteria 2522572158 2523105536 265
32 iso_pu_bacteria 2554235003 2554249301 265
33 iso_pu_bacteria 2597490356 2599100558 265
34 iso_pu_bacteria 2509276021 2509390389 267
35 iso_pu_bacteria 2599185212 2599611407 267
36 iso_pu_bacteria 2599185316 2600022393 267
37 iso_pu_bacteria 2599185317 2600027415 267
38 iso_pu_bacteria 2599185322 2600057355 267
39 iso_pu_bacteria 2599185325 2600075668 267
40 iso_pu_bacteria 2600254930 2600356876 267
41 iso_pu_bacteria 2667528176 2671124454 267
42 iso_pu_bacteria 2841864319 2841866284 267
43 iso_pu_bacteria 2842341865 2842342168 267
44 iso_pu_bacteria 2842363717 2842365856 267
45 iso_pu_bacteria 2848297114 2848297756 267
46 iso_pu_bacteria 2884960567 2884965341 267
47 iso_pu_bacteria 2919404418 2919405566 267
48 iso_pu_bacteria 8054002106 8054007905 267
49 3300005289 Ga0065704_10082726 Ga0065704_100827264 269
50 3300025292 Ga0209676_1000077 Ga0209676_1000077201 269
51 3300025298 Ga0209050_1002213 Ga0209050_10022139 269
52 3300031731 Ga0307405_10001621 Ga0307405_100016214 269
53 3300031824 Ga0307413_10005521 Ga0307413_100055214 269
54 3300031852 Ga0307410_10062664 Ga0307410_100626643 269
55 3300032004 Ga0307414_10000294 Ga0307414_100002947 269
56 3300048924 Ga0496121_0144844 Ga0496121_0144844_216_1025 269
57 3300048927 Ga0496124_0000220 Ga0496124_0000220_77102_77911 269
58 3300048929 Ga0496126_0000243 Ga0496126_0000243_86471_87280 269
59 2162886007 SwRhRL2b_contig_2381925 SwRhRL2b_0194.00002020 271
60 3300002773 JGI25152J39213_1016234 JGI25152J39213_10162342 271
61 3300002774 JGI25150J39212_1000423 JGI25150J39212_100042315 271
62 3300003215 JGI25153J46596_10000785 JGI25153J46596_1000078515 271
63 3300003320 rootH2_10057517 rootH2_100575172 271
64 3300003781 Ga0055536_1000156 Ga0055536_100015646 271
65 3300003791 Ga0055530_10007197 Ga0055530_100071972 271
66 3300003794 Ga0055531_10000121 Ga0055531_1000012118 271
67 3300005262 Ga0065165_1000001 Ga0065165_1000001230 271
68 3300005262 Ga0065165_1000526 Ga0065165_100052614 271
69 3300005262 Ga0065165_1001468 Ga0065165_100146815 271
70 3300005289 Ga0065704_10070189 Ga0065704_1007018940 271
71 3300005347 Ga0070668_100071812 Ga0070668_1000718121 271
72 3300005355 Ga0070671_100058841 Ga0070671_1000588411 271
73 3300005367 Ga0070667_100007128 Ga0070667_1000071288 271
74 3300005548 Ga0070665_100000686 Ga0070665_1000006862 271
75 3300005548 Ga0070665_100084934 Ga0070665_1000849343 271
76 3300005548 Ga0070665_100112636 Ga0070665_1001126363 271
77 3300005841 Ga0068863_100000980 Ga0068863_1000009809 271
78 3300005843 Ga0068860_100001156 Ga0068860_10000115629 271
79 3300005844 Ga0068862_100107961 Ga0068862_1001079613 271
80 3300006038 Ga0075365_10073543 Ga0075365_100735433 271
81 3300009011 Ga0105251_10002713 Ga0105251_1000271310 271
82 3300009101 Ga0105247_10087880 Ga0105247_100878802 271
83 3300009177 Ga0105248_10026552 Ga0105248_100265522 271
84 3300013306 Ga0163162_10495055 Ga0163162_104950552 271
85 3300017792 Ga0163161_10130526 Ga0163161_101305262 271
86 3300017792 Ga0163161_10146270 Ga0163161_101462701 271
87 3300025226 Ga0209674_100403 Ga0209674_10040315 271
88 3300025231 Ga0207427_104447 Ga0207427_1044473 271
89 3300025245 Ga0207425_1000358 Ga0207425_100035814 271
90 3300025258 Ga0209129_1005802 Ga0209129_10058022 271
91 3300025292 Ga0209676_1000031 Ga0209676_1000031318 271
92 3300025294 Ga0209025_1000202 Ga0209025_1000202109 271
93 3300025297 Ga0209758_1000763 Ga0209758_100076314 271
94 3300025298 Ga0209050_1000135 Ga0209050_1000135128 271
95 3300025304 Ga0209257_1000050 Ga0209257_1000050112 271
96 3300025304 Ga0209257_1040806 Ga0209257_10408062 271
97 3300025735 Ga0207713_1029399 Ga0207713_10293993 271
98 3300025923 Ga0207681_10010254 Ga0207681_100102547 271
99 3300025925 Ga0207650_10016472 Ga0207650_100164726 271
100 3300025941 Ga0207711_10002655 Ga0207711_1000265511 271
101 3300025941 Ga0207711_10252698 Ga0207711_102526982 271
102 3300025972 Ga0207668_10195552 Ga0207668_101955522 271
103 3300025986 Ga0207658_10003596 Ga0207658_100035965 271
104 3300026088 Ga0207641_10000469 Ga0207641_1000046943 271
105 3300028379 Ga0268266_10000804 Ga0268266_100008042 271
106 3300028379 Ga0268266_10120029 Ga0268266_101200292 271
107 3300028379 Ga0268266_10294412 Ga0268266_102944122 271
108 3300028381 Ga0268264_10036101 Ga0268264_100361013 271
109 3300030733 Ga0314311_1050202 Ga0314311_10502022 271
110 3300031731 Ga0307405_10132414 Ga0307405_101324141 271
111 3300039447 Ga0436361_0244142 Ga0436361_0244142_422_1237 271
112 3300044842 Ga0466957_0000863 Ga0466957_0000863_5163_5993 271
113 3300044842 Ga0466957_0087416 Ga0466957_0087416_380_1210 271
114 3300046501 Ga0495607_0000019 Ga0495607_0000019_87344_88159 271
115 3300046507 Ga0495606_0002356 Ga0495606_0002356_3416_4231 271
116 3300046522 Ga0495643_0000035 Ga0495643_0000035_34193_35008 271
117 3300046522 Ga0495643_0005795 Ga0495643_0005795_6857_7672 271
118 3300048909 Ga0496106_0132969 Ga0496106_0132969_543_1358 271
119 3300048919 Ga0496116_0031796 Ga0496116_0031796_663_1478 271
120 3300048919 Ga0496116_0038254 Ga0496116_0038254_1134_1949 271
121 3300048920 Ga0496117_0039941 Ga0496117_0039941_1917_2753 271
122 3300048920 Ga0496117_0193700 Ga0496117_0193700_126_941 271
123 3300048921 Ga0496118_0000343 Ga0496118_0000343_32427_33263 271
124 3300048921 Ga0496118_0045147 Ga0496118_0045147_2263_3078 271
125 3300048921 Ga0496118_0113505 Ga0496118_0113505_684_1499 271
126 3300048923 Ga0496120_0036837 Ga0496120_0036837_1281_2096 271
127 3300048924 Ga0496121_0101185 Ga0496121_0101185_179_994 271
128 3300048925 Ga0496122_0008964 Ga0496122_0008964_1724_2539 271
129 3300048926 Ga0496123_0004205 Ga0496123_0004205_1385_2200 271
130 3300048926 Ga0496123_0134661 Ga0496123_0134661_267_1082 271
131 3300048927 Ga0496124_0001047 Ga0496124_0001047_25758_26573 271
132 3300048927 Ga0496124_0019718 Ga0496124_0019718_3074_3889 271
133 3300048927 Ga0496124_0164581 Ga0496124_0164581_781_1596 271
134 3300048927 Ga0496124_0176338 Ga0496124_0176338_262_1077 271
135 3300048928 Ga0496125_0003030 Ga0496125_0003030_15643_16458 271
136 3300048928 Ga0496125_0024850 Ga0496125_0024850_1429_2244 271
137 3300048928 Ga0496125_0100693 Ga0496125_0100693_1189_2004 271
138 3300048928 Ga0496125_0283027 Ga0496125_0283027_53_868 271
139 3300048929 Ga0496126_0009054 Ga0496126_0009054_4100_4915 271
140 3300048929 Ga0496126_0029975 Ga0496126_0029975_3642_4457 271
141 3300048929 Ga0496126_0486592 Ga0496126_0486592_42_857 271
142 3300049571 Ga0501034_0270321 Ga0501034_0270321_500_1315 271
143 3300049742 Ga0501080_0400720 Ga0501080_0400720_303_1118 271
144 3300049758 Ga0501241_000780 Ga0501241_000780_3286_4101 271
145 3300050492 nmdc:mga0yw44_19099_c1 nmdc:mga0yw44_19099_c1_2765_3580 271
146 3300050516 nmdc:mga0sz30_63278_c1 nmdc:mga0sz30_63278_c1_186_1001 271
147 3300053096 Ga0500641_0032129 Ga0500641_0032129_947_1762 271
148 3300053160 Ga0500633_0000554 Ga0500633_0000554_3414_4229 271
149 3300053161 Ga0500634_0000010 Ga0500634_0000010_122750_123565 271
150 3300053730 Ga0500645_036780 Ga0500645_036780_333_1148 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

8

180

0.9

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

11

156

0.9

PF05368

NmrA

NmrA-like family

10

175

0.85

PF07993

NAD_binding_4

Male sterility protein

43

205

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

11

196

0.81

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

10

219

0.81

PF13460

NAD_binding_10

NAD(P)H-binding

14

208

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k3p-assembly1.cif.gz_B the structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni 0.8418 2 262
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8345 1 258
1lrk-assembly1.cif.gz_A crystal structure of escherichia coli udp-galactose 4-epimerase mutant y299c complexed with udp-n-acetylglucosamine 0.8293 1 267
4wok-assembly1.cif.gz_A crystal structure of udp-glucose 4-epimerase from brucella ovis in complex with nad 0.8285 2 271
4wok-assembly1.cif.gz_A crystal structure of udp-glucose 4-epimerase from brucella ovis in complex with nad 0.8229 2 271
ID Description Score Start End Superfamily
af_A0A1D6GVM8_196_300_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9064 1 97 3.40.50.20
af_I1KVW6_141_273_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.902 1 98 3.40.50.20
af_I1KG15_128_276_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8788 1 100 3.40.50.720
af_I1LJN4_7_360_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8751 2 225 3.40.50.720
af_A0A1D6MTK5_41_178_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.869 2 109 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2T5U769-F1-model_v4 RmlD substrate binding domain-containing protein 0.9922 121 271 GO:0004029
GO:0005737
AF-F3ZB88-F1-model_v4 Putative NAD-dependent epimerase/dehydratase 0.9919 1 271 GO:0004029
GO:0005737
AF-F3ZB88-F1-model_v4 Putative NAD-dependent epimerase/dehydratase 0.9883 1 271 GO:0004029
GO:0005737
AF-H0E036-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) 0.9882 2 271 GO:0003978
GO:0004029
GO:0005737
AF-A0A839VRS0-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9858 45 271 GO:0004029
GO:0005737

Feature Viewer

pLDDT pTM Quality
93.17 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map