F209903

General Info

Members Datasets Scaffolds Average Seq Length
150 104 149 163

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0024576|Ga0501047_0024576_2783_3352
Length 189
Sequence VRGTLCNIELSSSAISLFRGFEMGSPLHNPKLLSLEAAVARRRELAAAGKRVVLTNGVFDLLHAGHVYFLQAARAQGDALFVALNASESVRQLKGPTRPVVDTPERAYCLGSLSCVDAVVVFGTPRLDAEIRALRPDVYCKAGDYTLEKLDAGERAALQQAGTRIEFLPFLPGFSTTSLIARIKAAGEI

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
63 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
83 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
92 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 3.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10183061 3300003320 Bacteria 7998
2 rootL2_10120665 3300003322 Bacteria 3136
3 Ga0070658_10265634 3300005327 Bacteria 1458
4 Ga0070676_10148511 3300005328 Unclassified 1498
5 Ga0070677_10074505 3300005333 Bacteria 1436
6 Ga0070692_10001679 3300005345 Bacteria 8192
7 Ga0070673_100243367 3300005364 Bacteria 1565
8 Ga0070701_10054802 3300005438 Bacteria 2080
9 Ga0070711_101308499 3300005439 Bacteria 629
10 Ga0070705_100624764 3300005440 Bacteria 836
11 Ga0070694_100057205 3300005444 Bacteria 2650
12 Ga0070694_100798050 3300005444 Bacteria 774
13 Ga0070681_11104037 3300005458 Bacteria 714
14 Ga0070698_101132443 3300005471 Bacteria 731
15 Ga0070699_100106744 3300005518 Bacteria 2457
16 Ga0070699_100276611 3300005518 Bacteria 1503
17 Ga0070679_100028620 3300005530 Bacteria 5495
18 Ga0070684_100238208 3300005535 Bacteria 1662
19 Ga0070695_100111850 3300005545 Bacteria 1854
20 Ga0070696_100024591 3300005546 Bacteria 4094
21 Ga0070704_100054718 3300005549 Bacteria 2825
22 Ga0070704_100171466 3300005549 Bacteria 1726
23 Ga0070704_100210518 3300005549 Bacteria 1575
24 Ga0068855_100424788 3300005563 Bacteria 1453
25 Ga0068857_100020981 3300005577 Bacteria 5748
26 Ga0068857_100037428 3300005577 Bacteria 4298
27 Ga0068857_100497149 3300005577 Bacteria 1144
28 Ga0068856_100001531 3300005614 Bacteria 24224
29 Ga0070702_100215692 3300005615 Bacteria 1280
30 Ga0068864_101955029 3300005618 Bacteria 592
31 Ga0070717_10001137 3300006028 Bacteria 17980
32 Ga0075428_100253913 3300006844 Bacteria 1894
33 Ga0075428_100813127 3300006844 Bacteria 993
34 Ga0075430_100339007 3300006846 Bacteria 1242
35 Ga0075431_100047339 3300006847 Bacteria 4433
36 Ga0075433_10005144 3300006852 Bacteria 10261
37 Ga0075434_100128437 3300006871 Bacteria 2552
38 Ga0075429_100508899 3300006880 Bacteria 1055
39 Ga0068865_100769462 3300006881 Bacteria 828
40 Ga0075435_100884954 3300007076 Unclassified 778
41 Ga0105240_10794318 3300009093 Bacteria 1026
42 Ga0105243_10159944 3300009148 Bacteria 1941
43 Ga0105237_11098879 3300009545 Bacteria 802
44 Ga0105238_10094303 3300009551 Bacteria 2981
45 Ga0105249_10257414 3300009553 Bacteria 1733
46 Ga0105246_11046718 3300011119 Bacteria 742
47 Ga0157370_10251070 3300013104 Unclassified 1636
48 Ga0157372_10006972 3300013307 Bacteria 12031
49 Ga0163163_10235275 3300014325 Unclassified 1881
50 Ga0213875_10034160 3300021388 Bacteria 2401
51 Ga0207645_10706921 3300025907 Unclassified 685
52 Ga0207705_10195572 3300025909 Bacteria 1531
53 Ga0207707_10823581 3300025912 Bacteria 772
54 Ga0207695_11294193 3300025913 Unclassified 609
55 Ga0207694_10067772 3300025924 Bacteria 2786
56 Ga0207669_10007871 3300025937 Bacteria 4966
57 Ga0207661_10906148 3300025944 Bacteria 812
58 Ga0207667_10363822 3300025949 Bacteria 1475
59 Ga0207651_10081571 3300025960 Bacteria 2332
60 Ga0207708_11191861 3300026075 Unclassified 666
61 Ga0207702_10001191 3300026078 Bacteria 26401
62 Ga0207676_11769637 3300026095 Bacteria 616
63 Ga0207674_10035536 3300026116 Bacteria 5200
64 Ga0207674_10075731 3300026116 Bacteria 3374
65 Ga0265337_1094575 3300028556 Unclassified 814
66 Ga0265319_1003846 3300028563 Bacteria 7682
67 Ga0265319_1009728 3300028563 Bacteria 4066
68 Ga0265319_1077984 3300028563 Bacteria 1055
69 Ga0265319_1102150 3300028563 Bacteria 900
70 Ga0265318_10018079 3300028577 Bacteria 2883
71 Ga0265318_10036002 3300028577 Bacteria 1901
72 Ga0265323_10000387 3300028653 Bacteria 25382
73 Ga0265323_10001967 3300028653 Bacteria 9682
74 Ga0265323_10013927 3300028653 Bacteria 3196
75 Ga0265323_10034803 3300028653 Bacteria 1859
76 Ga0265323_10077181 3300028653 Unclassified 1129
77 Ga0265323_10090302 3300028653 Unclassified 1024
78 Ga0265323_10142238 3300028653 Bacteria 771
79 Ga0265322_10002279 3300028654 Bacteria 5942
80 Ga0265322_10005863 3300028654 Bacteria 3623
81 Ga0265330_10005843 3300031235 Bacteria 6106
82 Ga0265320_10001034 3300031240 Bacteria 20687
83 Ga0265320_10007138 3300031240 Bacteria 6965
84 Ga0265320_10049195 3300031240 Bacteria 2053
85 Ga0265339_10238299 3300031249 Unclassified 884
86 Ga0265331_10196498 3300031250 Bacteria 909
87 Ga0265327_10006032 3300031251 Bacteria 9832
88 Ga0265327_10070108 3300031251 Bacteria 1757
89 Ga0265327_10296987 3300031251 Unclassified 712
90 Ga0265316_10014295 3300031344 Bacteria 6993
91 Ga0265316_10022793 3300031344 Bacteria 5270
92 Ga0265316_10057907 3300031344 Bacteria 3020
93 Ga0265316_10113639 3300031344 Bacteria 2049
94 Ga0265316_10350913 3300031344 Unclassified 1068
95 Ga0265316_10528160 3300031344 Bacteria 841
96 Ga0265314_10030718 3300031711 Bacteria 3973
97 Ga0265314_10147638 3300031711 Bacteria 1446
98 Ga0265314_10188836 3300031711 Bacteria 1228
99 Ga0265342_10004536 3300031712 Bacteria 10889
100 Ga0265342_10097046 3300031712 Unclassified 1683
101 Ga0307406_11272010 3300031901 Bacteria 641
102 Ga0436364_1313014 3300037853 Bacteria 2753
103 Ga0451577_0060815 3300042876 Bacteria 3368
104 Ga0451577_0278604 3300042876 Bacteria 1515
105 Ga0453684_0023976 3300044712 Bacteria 8947
106 Ga0453684_0146836 3300044712 Bacteria 2808
107 Ga0453684_0432239 3300044712 Bacteria 1468
108 Ga0466971_0090063 3300044719 Unclassified 1404
109 Ga0466970_0518012 3300044765 Bacteria 688
110 Ga0466957_0186699 3300044842 Bacteria 1356
111 Ga0466960_0028979 3300044901 Bacteria 2537
112 Ga0466959_0047283 3300045049 Bacteria 3165
113 Ga0451576_0049466 3300045051 Bacteria 4411
114 Ga0451576_2035560 3300045051 Unclassified 591
115 Ga0466967_0152784 3300045976 Bacteria 2159
116 Ga0466967_0298290 3300045976 Bacteria 1550
117 Ga0495611_0172761 3300046648 Unclassified 1010
118 Ga0495636_0298388 3300047318 Unclassified 753
119 Ga0501033_0001582 3300049570 Bacteria 20025
120 Ga0501037_0227425 3300049573 Unclassified 1310
121 Ga0501038_0490668 3300049574 Unclassified 940
122 Ga0501039_0603595 3300049575 Bacteria 860
123 Ga0501046_0005695 3300049580 Bacteria 11118
124 Ga0501047_0020229 3300049581 Bacteria 6392
125 Ga0501047_0024576 3300049581 Bacteria 5783
126 Ga0501047_0187908 3300049581 Bacteria 1930
127 Ga0501047_1082691 3300049581 Unclassified 615
128 Ga0501048_0133329 3300049582 Bacteria 1755
129 Ga0501070_0191306 3300049586 Bacteria 1682
130 Ga0501243_000256 3300049675 Bacteria 6759
131 Ga0501080_0251552 3300049742 Unclassified 1611
132 Ga0501083_0001207 3300049744 Bacteria 17492
133 Ga0501083_0002017 3300049744 Bacteria 13968
134 Ga0501083_0096537 3300049744 Bacteria 1950
135 Ga0501035_0003775 3300049822 Bacteria 14435
136 Ga0501035_0137838 3300049822 Bacteria 2123
137 Ga0501035_0415487 3300049822 Bacteria 1117
138 Ga0501035_0541014 3300049822 Unclassified 955
139 Ga0501044_0001980 3300049823 Bacteria 23675
140 Ga0501044_0100868 3300049823 Bacteria 2904
141 nmdc:mga05p37_88576_c1 3300050507 Bacteria 3815
142 nmdc:mga09592_1060837_c1 3300050508 Bacteria 675
143 nmdc:mga0qj67_537414_c1 3300050509 Bacteria 938
144 nmdc:mga0qj67_809162_c1 3300050509 Bacteria 741
145 nmdc:mga06r32_217093_c1 3300050510 Bacteria 1900
146 nmdc:mga0rr50_94991_c1 3300050513 Unclassified 2329
147 nmdc:mga0a205_6180_c1 3300050515 Bacteria 10808
148 Ga0501084_0308402 3300054114 Bacteria 1337
149 Ga0501082_0251484 3300060353 Bacteria 1538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005345 Ga0070692_10001679 Ga0070692_100016796 140
2 3300005545 Ga0070695_100111850 Ga0070695_1001118502 140
3 3300005577 Ga0068857_100037428 Ga0068857_1000374285 140
4 3300005615 Ga0070702_100215692 Ga0070702_1002156922 140
5 3300009553 Ga0105249_10257414 Ga0105249_102574142 140
6 3300011119 Ga0105246_11046718 Ga0105246_110467182 140
7 3300026116 Ga0207674_10075731 Ga0207674_100757314 140
8 3300005440 Ga0070705_100624764 Ga0070705_1006247642 142
9 3300005444 Ga0070694_100057205 Ga0070694_1000572052 142
10 3300005518 Ga0070699_100106744 Ga0070699_1001067442 142
11 3300005546 Ga0070696_100024591 Ga0070696_1000245914 142
12 3300006881 Ga0068865_100769462 Ga0068865_1007694622 142
13 3300005438 Ga0070701_10054802 Ga0070701_100548022 148
14 3300005549 Ga0070704_100054718 Ga0070704_1000547182 148
15 3300006844 Ga0075428_100813127 Ga0075428_1008131271 148
16 3300045976 Ga0466967_0298290 Ga0466967_0298290_996_1463 152
17 3300003322 rootL2_10120665 rootL2_101206652 154
18 3300005563 Ga0068855_100424788 Ga0068855_1004247882 154
19 3300005577 Ga0068857_100497149 Ga0068857_1004971492 154
20 3300025949 Ga0207667_10363822 Ga0207667_103638223 154
21 3300005328 Ga0070676_10148511 Ga0070676_101485112 155
22 3300005333 Ga0070677_10074505 Ga0070677_100745051 155
23 3300025907 Ga0207645_10706921 Ga0207645_107069212 155
24 3300025937 Ga0207669_10007871 Ga0207669_100078712 155
25 3300005471 Ga0070698_101132443 Ga0070698_1011324431 156
26 3300046648 Ga0495611_0172761 Ga0495611_0172761_527_997 156
27 3300005518 Ga0070699_100276611 Ga0070699_1002766112 157
28 3300006846 Ga0075430_100339007 Ga0075430_1003390072 157
29 3300006847 Ga0075431_100047339 Ga0075431_1000473392 157
30 3300044712 Ga0453684_0023976 Ga0453684_0023976_2543_3016 157
31 3300044842 Ga0466957_0186699 Ga0466957_0186699_248_721 157
32 3300045051 Ga0451576_2035560 Ga0451576_2035560_63_536 157
33 3300050507 nmdc:mga05p37_88576_c1 nmdc:mga05p37_88576_c1_2945_3427 157
34 3300050509 nmdc:mga0qj67_537414_c1 nmdc:mga0qj67_537414_c1_332_814 157
35 3300050510 nmdc:mga06r32_217093_c1 nmdc:mga06r32_217093_c1_379_861 157
36 3300005535 Ga0070684_100238208 Ga0070684_1002382082 158
37 3300009545 Ga0105237_11098879 Ga0105237_110988792 158
38 3300009551 Ga0105238_10094303 Ga0105238_100943034 158
39 3300013307 Ga0157372_10006972 Ga0157372_100069727 158
40 3300025924 Ga0207694_10067772 Ga0207694_100677723 158
41 3300025944 Ga0207661_10906148 Ga0207661_109061482 158
42 3300049575 Ga0501039_0603595 Ga0501039_0603595_146_637 158
43 3300054114 Ga0501084_0308402 Ga0501084_0308402_525_1016 158
44 3300005549 Ga0070704_100210518 Ga0070704_1002105182 159
45 3300006852 Ga0075433_10005144 Ga0075433_100051442 159
46 3300006871 Ga0075434_100128437 Ga0075434_1001284372 159
47 3300007076 Ga0075435_100884954 Ga0075435_1008849542 159
48 3300021388 Ga0213875_10034160 Ga0213875_100341602 159
49 3300031711 Ga0265314_10147638 Ga0265314_101476382 159
50 3300037853 Ga0436364_1313014 Ga0436364_1313014_606_1097 159
51 3300044901 Ga0466960_0028979 Ga0466960_0028979_339_827 159
52 3300050509 nmdc:mga0qj67_809162_c1 nmdc:mga0qj67_809162_c1_129_614 159
53 iso_pu_bacteria 2786546940 2788432974 160
54 3300005444 Ga0070694_100798050 Ga0070694_1007980501 161
55 3300005549 Ga0070704_100171466 Ga0070704_1001714662 161
56 3300006880 Ga0075429_100508899 Ga0075429_1005088991 161
57 3300028563 Ga0265319_1009728 Ga0265319_10097284 161
58 3300031240 Ga0265320_10001034 Ga0265320_1000103411 161
59 3300050508 nmdc:mga09592_1060837_c1 nmdc:mga09592_1060837_c1_153_659 161
60 3300006844 Ga0075428_100253913 Ga0075428_1002539132 162
61 3300009093 Ga0105240_10794318 Ga0105240_107943182 162
62 3300009148 Ga0105243_10159944 Ga0105243_101599442 162
63 3300013104 Ga0157370_10251070 Ga0157370_102510702 162
64 3300025913 Ga0207695_11294193 Ga0207695_112941931 162
65 3300026075 Ga0207708_11191861 Ga0207708_111918612 162
66 3300050513 nmdc:mga0rr50_94991_c1 nmdc:mga0rr50_94991_c1_1598_2104 162
67 3300050515 nmdc:mga0a205_6180_c1 nmdc:mga0a205_6180_c1_7530_8036 162
68 3300028563 Ga0265319_1102150 Ga0265319_11021501 163
69 3300031901 Ga0307406_11272010 Ga0307406_112720101 163
70 3300003320 rootH2_10183061 rootH2_101830616 164
71 3300005327 Ga0070658_10265634 Ga0070658_102656342 164
72 3300005364 Ga0070673_100243367 Ga0070673_1002433672 164
73 3300005439 Ga0070711_101308499 Ga0070711_1013084991 164
74 3300005458 Ga0070681_11104037 Ga0070681_111040371 164
75 3300005530 Ga0070679_100028620 Ga0070679_1000286201 164
76 3300005577 Ga0068857_100020981 Ga0068857_1000209815 164
77 3300005614 Ga0068856_100001531 Ga0068856_10000153110 164
78 3300005618 Ga0068864_101955029 Ga0068864_1019550291 164
79 3300006028 Ga0070717_10001137 Ga0070717_1000113710 164
80 3300014325 Ga0163163_10235275 Ga0163163_102352752 164
81 3300025909 Ga0207705_10195572 Ga0207705_101955721 164
82 3300025912 Ga0207707_10823581 Ga0207707_108235811 164
83 3300025960 Ga0207651_10081571 Ga0207651_100815712 164
84 3300026078 Ga0207702_10001191 Ga0207702_1000119118 164
85 3300026095 Ga0207676_11769637 Ga0207676_117696371 164
86 3300026116 Ga0207674_10035536 Ga0207674_100355367 164
87 3300028556 Ga0265337_1094575 Ga0265337_10945751 164
88 3300028563 Ga0265319_1003846 Ga0265319_10038465 164
89 3300028563 Ga0265319_1077984 Ga0265319_10779842 164
90 3300028577 Ga0265318_10018079 Ga0265318_100180792 164
91 3300028577 Ga0265318_10036002 Ga0265318_100360022 164
92 3300028653 Ga0265323_10000387 Ga0265323_1000038722 164
93 3300028653 Ga0265323_10001967 Ga0265323_100019674 164
94 3300028653 Ga0265323_10013927 Ga0265323_100139272 164
95 3300028653 Ga0265323_10034803 Ga0265323_100348032 164
96 3300028653 Ga0265323_10077181 Ga0265323_100771812 164
97 3300028653 Ga0265323_10090302 Ga0265323_100903022 164
98 3300028653 Ga0265323_10142238 Ga0265323_101422381 164
99 3300028654 Ga0265322_10002279 Ga0265322_100022795 164
100 3300028654 Ga0265322_10005863 Ga0265322_100058633 164
101 3300031235 Ga0265330_10005843 Ga0265330_100058435 164
102 3300031240 Ga0265320_10007138 Ga0265320_100071382 164
103 3300031240 Ga0265320_10049195 Ga0265320_100491953 164
104 3300031249 Ga0265339_10238299 Ga0265339_102382992 164
105 3300031250 Ga0265331_10196498 Ga0265331_101964981 164
106 3300031251 Ga0265327_10006032 Ga0265327_100060329 164
107 3300031251 Ga0265327_10070108 Ga0265327_100701082 164
108 3300031251 Ga0265327_10296987 Ga0265327_102969872 164
109 3300031344 Ga0265316_10014295 Ga0265316_100142955 164
110 3300031344 Ga0265316_10022793 Ga0265316_100227937 164
111 3300031344 Ga0265316_10057907 Ga0265316_100579073 164
112 3300031344 Ga0265316_10113639 Ga0265316_101136393 164
113 3300031344 Ga0265316_10350913 Ga0265316_103509131 164
114 3300031344 Ga0265316_10528160 Ga0265316_105281602 164
115 3300031711 Ga0265314_10030718 Ga0265314_100307183 164
116 3300031711 Ga0265314_10188836 Ga0265314_101888362 164
117 3300031712 Ga0265342_10004536 Ga0265342_100045369 164
118 3300031712 Ga0265342_10097046 Ga0265342_100970462 164
119 3300042876 Ga0451577_0060815 Ga0451577_0060815_536_1060 164
120 3300042876 Ga0451577_0278604 Ga0451577_0278604_728_1225 164
121 3300044712 Ga0453684_0146836 Ga0453684_0146836_2230_2736 164
122 3300044712 Ga0453684_0432239 Ga0453684_0432239_647_1171 164
123 3300044719 Ga0466971_0090063 Ga0466971_0090063_368_862 164
124 3300044765 Ga0466970_0518012 Ga0466970_0518012_93_611 164
125 3300045049 Ga0466959_0047283 Ga0466959_0047283_291_788 164
126 3300045051 Ga0451576_0049466 Ga0451576_0049466_2701_3225 164
127 3300045976 Ga0466967_0152784 Ga0466967_0152784_876_1370 164
128 3300047318 Ga0495636_0298388 Ga0495636_0298388_45_542 164
129 3300049570 Ga0501033_0001582 Ga0501033_0001582_929_1432 164
130 3300049573 Ga0501037_0227425 Ga0501037_0227425_195_698 164
131 3300049574 Ga0501038_0490668 Ga0501038_0490668_193_696 164
132 3300049580 Ga0501046_0005695 Ga0501046_0005695_9326_9862 164
133 3300049581 Ga0501047_0020229 Ga0501047_0020229_3154_3690 164
134 3300049581 Ga0501047_0024576 Ga0501047_0024576_2783_3352 164
135 3300049581 Ga0501047_0187908 Ga0501047_0187908_1133_1636 164
136 3300049581 Ga0501047_1082691 Ga0501047_1082691_46_543 164
137 3300049582 Ga0501048_0133329 Ga0501048_0133329_474_977 164
138 3300049586 Ga0501070_0191306 Ga0501070_0191306_740_1237 164
139 3300049675 Ga0501243_000256 Ga0501243_000256_307_810 164
140 3300049742 Ga0501080_0251552 Ga0501080_0251552_251_754 164
141 3300049744 Ga0501083_0001207 Ga0501083_0001207_898_1395 164
142 3300049744 Ga0501083_0002017 Ga0501083_0002017_9187_9684 164
143 3300049744 Ga0501083_0096537 Ga0501083_0096537_1398_1898 164
144 3300049822 Ga0501035_0003775 Ga0501035_0003775_12867_13403 164
145 3300049822 Ga0501035_0137838 Ga0501035_0137838_331_834 164
146 3300049822 Ga0501035_0415487 Ga0501035_0415487_472_1041 164
147 3300049822 Ga0501035_0541014 Ga0501035_0541014_383_880 164
148 3300049823 Ga0501044_0001980 Ga0501044_0001980_11714_12211 164
149 3300049823 Ga0501044_0100868 Ga0501044_0100868_928_1431 164
150 3300060353 Ga0501082_0251484 Ga0501082_0251484_148_645 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

54

182

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.9267 6 144
1n1d-assembly1.cif.gz_A glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol 0.8809 26 157
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.8769 6 144
1n1d-assembly1.cif.gz_A glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol 0.8615 26 157
5x9q-assembly1.cif.gz_B crystal structure of hldc from burkholderia pseudomallei 0.8603 6 162
ID Description Score Start End Superfamily
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.953 7 161 3.40.50.620
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9238 7 161 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8859 26 157 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8663 26 157 3.40.50.620
af_Q18524_184_340_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8367 25 161 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A820G945-F1-model_v4 Cytidyltransferase-like domain-containing protein 0.9898 6 114 GO:0003824
GO:0009058
AF-A0A2N2L489-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase 0.9897 6 114 GO:0009058
GO:0016779
AF-A0A3D5UB32-F1-model_v4 Bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase 0.9893 6 114 GO:0009058
GO:0016301
AF-A0A7Y3D7N4-F1-model_v4 Adenylyltransferase/cytidyltransferase family protein 0.9893 5 116 GO:0009058
GO:0016779
AF-A0A7V4WAQ9-F1-model_v4 Bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase 0.9878 6 116 GO:0009058
GO:0016301

Feature Viewer

pLDDT pTM Quality
93.09 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map